KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02195Help
Entry
lpa_02195         CDS       T01232                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
lpa00010  Glycolysis / Gluconeogenesis
lpa00020  Citrate cycle (TCA cycle)
lpa00620  Pyruvate metabolism
lpa01100  Metabolic pathways
lpa01110  Biosynthesis of secondary metabolites
lpa01120  Microbial metabolism in diverse environments
lpa01130  Biosynthesis of antibiotics
lpa01200  Carbon metabolism
Module
lpa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpa_02195 (aceF)
   00020 Citrate cycle (TCA cycle)
    lpa_02195 (aceF)
   00620 Pyruvate metabolism
    lpa_02195 (aceF)
Enzymes [BR:lpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lpa_02195 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H PYNP_C RnfC_N NQRA HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADG24833
Position
complement(1723596..1725230)
Genome map
AA seq 544 aa AA seqDB search
MTKESEIKIPDIGGANQVDVIEILVKEGDQIEVDTPLITLESEKASMDIPSPISGTVTQI
LVKVGDKVSEGDLIVKAKSDTTTNISSSQEQKAESEKQNSQTRAEEQSVDTKATASTPGS
KDIEISIPDIGGANDVDVIDILVKPGMEVEKDQALITLEGDKATMDIPSPYAGKVIEMKI
KLGDKVSQGTPILTLKASAKSETPEIEKSQIKNISEQSIKEIEKPYEELKSEPISINNLE
IAESKSIIISAGPAVRRLAREFGVDLSLVQGSGRKSRVTKEDLQNYIKVRLNEKTTSGGF
SLPSNPAIDFSKFGSIETKPLNKIKKLTGANVHRSWITIPHVTQFDEADITDLEAFRKSE
SESTKNQDYKLTLLAFVCSVVCKALHAYPQFNASLDASGENLIYKKYYNIGIAVDTPNGL
VVPVIKNVDKLSVIDIAKEMSRLSTKAREKGLTPIDMSGGCFTISSLGGIGGTAFTPIVN
SPEVAILGLSRSVIKPIYDNKEFKPRLMLPISLSYDHRVIDGAEAARFTRFLCDCLGDIR
RVLL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaagtgaaattaaaattcctgatatcggtggcgctaatcaagttgatgtc
attgagattttagtaaaagagggtgatcagatcgaagtggatacaccattgattacgctt
gagtctgagaaggcaagcatggacatcccctctccaatatctggaacggtaacgcaaatt
ctcgttaaagtcggtgacaaagtatccgaaggcgatctcattgtcaaagccaagtcagat
acaacgacaaatatttccagttctcaagaacaaaaggctgaatcagaaaagcagaattcg
caaaccagagcagaagagcaatctgttgatacaaaggcaactgcatctacacctggctcc
aaagatattgaaatatctatcccggatattggtggtgcaaatgacgttgatgtaattgat
attttagtcaaaccagggatggaagtagaaaaggatcaggcattaattacattagagggt
gataaagcaacgatggatattccttcgccctatgcaggtaaagtcatcgaaatgaaaatt
aaattaggggataaagtatctcaaggtactcctattctaactctaaaagcctcagcaaaa
tctgagacacctgaaatcgaaaaaagccagattaaaaatatctcagaacaatctataaag
gaaatagaaaagccatatgaagaactaaaatccgaaccaatatcaattaataacctggag
atagctgaatcaaaaagtatcataatatctgcaggtccagccgtaagaaggttggcaaga
gagtttggggtcgatttatctttggttcagggaagtgggagaaaatctcgtgttacaaaa
gaagacctgcaaaattatatcaaagtacgtttaaatgaaaaaactacgtctggtggcttc
agcttaccgtcaaatccagccattgatttcagtaaatttggttcaattgaaacaaagcct
ttaaataaaattaaaaagcttactggagcaaacgtacatcgctcttggataaccattcca
catgtcactcagtttgacgaagcagatattacagacctggaggcgtttagaaaatcagaa
tcagagagcactaaaaatcaagattacaaattaactctgttagcatttgtttgtagcgta
gtttgtaaggctctccatgcttacccgcaatttaatgcgtcactggatgccagtggtgaa
aatttaatttataaaaaatattataatataggtatagcagtagatacacctaacggtctg
gtagttcctgtaataaagaatgttgataaattgagtgtgattgatattgcaaaggaaatg
tccagactcagtacgaaagctagagaaaagggattaacacctattgatatgtcaggcggt
tgttttacaatttccagccttggcggtataggcggaacggcatttactcctattgtaaat
agcccggaagttgcaattttgggcttatcaagatcagtaataaaacccatatacgataat
aaagagtttaagcccagattgatgttgcctatttccctttcttacgatcatagagtaatc
gatggcgctgaggcagcccggtttactcgctttctttgtgattgtttaggtgatattaga
agagttttactctga

DBGET integrated database retrieval system