KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02240Help
Entry
lpa_02240         CDS       T01232                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lpa_02240 (folK)
Enzymes [BR:lpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     lpa_02240 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1765820..1766245
Genome map
AA seq 141 aa AA seqDB search
MNVCYLSLGSNQKNPERQIRQAIKEIKQIPSTCLIKASRLYWNKAWGFENQQEFCNVVIE
IQTTLLPHKLLKWCQKIENRHKRVRRKFWGPRTLDIDIILYGYRLIRTKNLIVPHPCFHL
RDFVLVPLRELNSNLKIPNYT
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttgctatctgagcttgggatcgaatcaaaaaaatcctgagcgccaaataaga
caagccattaaagaaatcaaacagattccatcaacatgccttatcaaggcgtctcgctta
tattggaataaggcctggggctttgaaaatcaacaggaattttgtaatgtcgttatagag
atacaaactactctgttaccccataagctccttaagtggtgccagaaaatagaaaacagg
cacaagcgagtcaggagaaagttttgggggccaagaacattagatattgatatcatttta
tatggctatagattaattcgcacaaaaaacttaatcgttccacatccttgtttccattta
cgagattttgttcttgttcctctaagagaattaaactctaatttaaaaataccaaattac
acatag

DBGET integrated database retrieval system