KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02263Help
Entry
lpa_02263         CDS       T01232                                 

Gene name
odp2
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
lpa00010  Glycolysis / Gluconeogenesis
lpa00020  Citrate cycle (TCA cycle)
lpa00620  Pyruvate metabolism
lpa01100  Metabolic pathways
lpa01110  Biosynthesis of secondary metabolites
lpa01120  Microbial metabolism in diverse environments
lpa01130  Biosynthesis of antibiotics
lpa01200  Carbon metabolism
Module
lpa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpa_02263 (odp2)
   00020 Citrate cycle (TCA cycle)
    lpa_02263 (odp2)
   00620 Pyruvate metabolism
    lpa_02263 (odp2)
Enzymes [BR:lpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lpa_02263 (odp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Bac_DNA_binding Bclx_interact
Motif
Other DBs
NCBI-ProteinID: ADG24890
Position
1785196..1786308
Genome map
AA seq 370 aa AA seqDB search
MNIFNLPDLGEGLPDAEIHEWFVKEGDTVKADQPLVSMETAKAVVDVPCPQSGTIAKLYG
KPGDVIKTGEPLVAFVSTTEKPADKGTVVGNLEESTDVSEDNFIIGSQRSSHRVKTTPAV
RMLAKKLGVDLSSLKGSGDNGVITREDVQNQANINSQPPAGFEPLRGVRRAMLNSMVQSH
AEIVPVSIFDEADIHIWKPNTDITVRLIRAIIHASKKEPALNAWFDTKHAARRCFKEVHL
GIAMDNEEGLFVPVIHDAEKYSDSELRKIIDEFKESVRNRAVSADKLKGATITLSNFGKF
SGRFASPIIVPPMVAILAVGRLYKAAVINDEDKIEAHKMLPLSLSFDHRAITGGEATRFL
GAVIESLQQA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttttaatctacccgatttaggtgaaggtttacctgacgctgaaattcatgaa
tggtttgttaaggaaggcgacacagttaaagcagatcaacctttagtttctatggaaacg
gcaaaagcagttgttgacgtaccctgccctcaatcaggcactatcgcaaaactttatggc
aaaccaggtgacgttatcaaaacaggtgagcctcttgtagcgtttgtttcaactaccgaa
aaacctgcagataaaggcacagttgttggtaatctggaggaaagtactgatgtgtcagaa
gataattttattattggaagtcagcgttcttctcaccgcgttaagacaacacctgctgta
agaatgttagcaaaaaaattaggagttgatttaagctctttaaaaggtagtggtgacaat
ggtgttattactcgagaagatgttcaaaatcaggccaatatcaattcacaaccacctgcc
gggtttgagcccttgcgaggtgttaggcgagccatgcttaatagcatggtacaatctcat
gcagaaatagttccagtcagtatttttgatgaagcagatatccatatttggaaacccaac
acagacattactgttcgtttaatccgggctattatccatgcgtcaaaaaaggaacctgct
cttaatgcctggtttgataccaaacatgccgcacgtagatgttttaaagaagtgcatctt
ggcattgccatggacaatgaggaaggtttatttgttcctgttatccatgatgcagaaaaa
tattccgacagtgaattaagaaaaataattgatgaattcaaagaatcggttcgtaatcgg
gcggttagtgcagacaagctaaaaggggcgacaattacgctgtctaattttggaaaattt
tcaggacgttttgccagtccaataattgttcctccaatggtagcgattttagcggttgga
agactttataaagctgccgtaattaatgatgaggataaaattgaagcccacaaaatgctt
cctttatccttgagctttgatcatagagccattaccggaggcgaggccactcgattctta
ggtgccgttattgaatctttgcaacaagcatga

DBGET integrated database retrieval system