KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02315Help
Entry
lpa_02315         CDS       T01232                                 

Gene name
yfcX
Definition
yfcX enoyl CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpa_02315 (yfcX)
   01212 Fatty acid metabolism
    lpa_02315 (yfcX)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    lpa_02315 (yfcX)
   00650 Butanoate metabolism
    lpa_02315 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    lpa_02315 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    lpa_02315 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lpa_02315 (yfcX)
   00310 Lysine degradation
    lpa_02315 (yfcX)
   00380 Tryptophan metabolism
    lpa_02315 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lpa_02315 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    lpa_02315 (yfcX)
   00281 Geraniol degradation
    lpa_02315 (yfcX)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    lpa_02315 (yfcX)
Enzymes [BR:lpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     lpa_02315 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     lpa_02315 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     lpa_02315 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1824304..1826322)
Genome map
AA seq 672 aa AA seqDB search
MNNYKHWDLQRDKDAILWLGLNRRDAAVNSINEEVLDELNSLLHEISHDKKAMGLIIYSL
KEKGFIAGADVNAFSQFESSSQAVDFLQKGQTVFARLQALSIPSVAMIDGFCMGGGYELA
LACTYRIATDDKDTRIGLPEVMLGIHPGWGGTVRLPQLIGGFKALSQVILTGSAIPAAKA
KNLGMIDEVVPVRQLRRAAVYFIKNKPPRHRASFIESLTNSSLLRKAIAYLLRYNVAKRV
RKEHYPAPYAVIDLWEKEGGVGERAYLKEVDSIEKLVSQNDTAKNLIRAFLLRERLKGFA
KDSHFKAAHVHVIGAGVMGGDIAAWCALRGLQVTLQDKSYEQIAPAIGRAHKLYSKKLRK
PRLIQAAMDRLIADPEGHGIKRADVIIEAVFENLAVKQEIMKTVEKNAKKDAIIATNTSS
IPLDEISSVMSKPERLVGIHFFNPVAKMDLVEIVSSSSTAKKIQQSSCAFVNQIGKLPLP
VKSSPGFLINRVLMPYLMECVQLLDEGYSAETIDEAALQFGMFMGPVELADTVGMDVCLA
VAENLTSHFGGTIPQRLRDLVKEGKLGRKTGEGFYKYKNGKVIKKKAPSHVDKTIADRLI
LRMVNESAACIREKVVEDSDLLDAGMIFATGFAPFRGGPMNYANDFGKDKLETLFKTFES
KYGERFKVDTSL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaataattataaacattgggatttacaacgagacaaagatgccattctgtggcttgga
ttaaatagaagagatgctgctgttaatagtattaatgaagaagtcttggatgagttaaac
agcttgctgcatgaaatatcgcatgataaaaaagcaatgggattaattatttattcgctc
aaggaaaaagggtttattgcgggtgctgatgttaacgctttttcacaatttgagagctct
tcacaagcggttgattttttgcagaaaggacaaactgtatttgcccggttgcaagcttta
tcaattccaagtgtcgcaatgatcgatggtttttgcatgggcggtggttatgagttagct
ttagcttgcacttaccgaatcgcaacggatgacaaagacacacgtattggtttgcctgaa
gtaatgctgggtattcatccagggtggggcggtactgtgcgtttgcctcagttaataggt
ggttttaaagctttatcacaagtcatattaaccggtagtgcaatacctgctgcaaaagct
aaaaacctcggcatgattgatgaggtagtacctgttcgtcagctaagaagggctgctgtt
tatttcataaagaataaaccaccacgacacagggcatcatttattgaaagtttaacgaat
agctctctgcttagaaaagctatcgcttatttactgcgttataacgtagccaagcgagtt
cgaaaagaacattatcctgcaccatatgccgtgattgacctgtgggaaaaagaaggggga
gtgggagagagggcttatcttaaagaagtggactctatagaaaaacttgtatcccaaaat
gataccgccaagaatcttatcagagcatttttattgcgtgagcgattaaaagggtttgcc
aaagacagccacttcaaagcggctcatgttcatgtgattggagctggagttatgggaggg
gatatcgcggcctggtgtgctttgcgaggtcttcaggtcacattacaggataaatcttat
gaacaaattgcccctgcaatagggagagcacataaactttatagtaaaaaactgcgtaag
ccgcgattgatccaggcagcaatggatagattaatcgcagaccccgaagggcatgggata
aaacgagcagatgtcattattgaggctgttttcgaaaatttagctgttaaacaggaaata
atgaaaactgtggaaaaaaatgccaaaaaagatgcgatcatcgcgacaaacacctctagt
atcccacttgatgaaatcagtagtgtaatgagtaaaccagaacgcttggtaggcattcat
ttctttaatcctgtagctaaaatggatttggtagaaatagtcagcagctcatctactgca
aaaaaaattcagcagagctcttgcgcgttcgtcaatcaaattggcaaattgcctttgcct
gtcaaatcaagccctgggtttttaataaacagagtgctcatgccttatctaatggagtgc
gtacagttattggatgaaggatatagtgcggagacaatagatgaggccgcattacagttt
ggtatgtttatgggccctgttgaactggctgataccgtaggaatggatgtttgtcttgct
gtggccgaaaatctgaccagtcactttggtggtactattccacaaagattacgtgactta
gtaaaagaaggtaagctaggcagaaaaactggagaaggtttttataaatataaaaatgga
aaagtaattaagaaaaaggctccgtcacatgttgataaaaccattgcagacagattaatt
ttacgaatggtgaatgaatctgcagcttgtatacgtgagaaagtggttgaagattctgac
ttgttggatgctggaatgatctttgccacaggttttgctccattccgtggagggcctatg
aattacgcaaatgattttggtaaagataaactggaaactttatttaaaacatttgagtct
aaatacggcgaacgttttaaggtagataccagcttataa

DBGET integrated database retrieval system