KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02613Help
Entry
lpa_02613         CDS       T01232                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lpa_02613 (hemB)
Enzymes [BR:lpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     lpa_02613 (hemB)
Exosome [BR:lpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpa_02613 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095638..2096633
Genome map
AA seq 331 aa AA seqDB search
MNEYNLPLRLSRLRKNAMSRALVRETRLHTQQLIAPLFISEYLTEAKEISAMPGQFQLGL
NCIPEEIEALSKLGIPAVLLFGIPKQKDACGSESMNNNGIIQQAIKKIKSVNSDMLVITD
LCFCEYTDHGHCGVLDGSQINIASTLELLGKQAVSHAEAGADWVAPSGMTDGMVLAIRQA
LDTASFHDIPILSYSAKYCSCLYGPFREAAQGAPQFGDRKAYQMDPANSEEAVRETRLDL
EEGADMIMVKPAGFYLDIIYKLKQHFADVPLCAYQVSGEYSMIKNAAKNNLINEEQAMTE
SLIAIKRAGADFIISYFAKGMAELLNSQNFI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatataatttgcctttaagattatctcgtttaagaaaaaatgccatgtcaaga
gcattagtaagagagacgaggctgcatacacaacaactaattgctccattgtttattagc
gaatatttaactgaagcaaaagaaatcagcgctatgccaggccaatttcaactaggcctc
aattgtatacctgaggaaattgaagctttatcaaaattaggcatccctgcggtcctctta
ttcggtatccctaagcaaaaagacgcttgcggcagtgaatcaatgaataataatgggatc
attcaacaagcgatcaaaaaaattaaatccgttaatagtgacatgttagtgatcactgat
ctttgcttttgcgaatacaccgatcatggtcattgcggggttctggatggtagtcaaatt
aatatcgcttctaccttagagttattaggaaaacaagcagtaagtcacgctgaagcaggt
gctgactgggttgctcccagtggcatgacagacggaatggttttggctatacgccaggca
ttggatactgcctcatttcatgatattcctattttaagttacagtgccaaatattgctcg
tgcctttatgggccttttagagaggcagcgcagggtgcaccacagtttggcgataggaaa
gcgtatcaaatggatccggcaaatagtgaggaagctgtaagggaaacccgattagatctg
gaagaaggcgcagatatgattatggttaaaccagccggtttttatcttgatattatttat
aaacttaaacaacattttgctgatgtaccgctttgtgcctatcaggtcagcggtgaatat
tcgatgataaaaaatgcagcaaaaaataatctaatcaatgaagaacaagcaatgactgaa
agtctcattgcgattaaacgtgctggcgctgattttattatttcttattttgctaaaggc
atggctgagttattaaactctcaaaattttatttaa

DBGET integrated database retrieval system