KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02613Help
Entry
lpa_02613         CDS       T01232                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lpa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095638..2096633
Genome map
AA seq 331 aa AA seqDB search
MNEYNLPLRLSRLRKNAMSRALVRETRLHTQQLIAPLFISEYLTEAKEISAMPGQFQLGL
NCIPEEIEALSKLGIPAVLLFGIPKQKDACGSESMNNNGIIQQAIKKIKSVNSDMLVITD
LCFCEYTDHGHCGVLDGSQINIASTLELLGKQAVSHAEAGADWVAPSGMTDGMVLAIRQA
LDTASFHDIPILSYSAKYCSCLYGPFREAAQGAPQFGDRKAYQMDPANSEEAVRETRLDL
EEGADMIMVKPAGFYLDIIYKLKQHFADVPLCAYQVSGEYSMIKNAAKNNLINEEQAMTE
SLIAIKRAGADFIISYFAKGMAELLNSQNFI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatataatttgcctttaagattatctcgtttaagaaaaaatgccatgtcaaga
gcattagtaagagagacgaggctgcatacacaacaactaattgctccattgtttattagc
gaatatttaactgaagcaaaagaaatcagcgctatgccaggccaatttcaactaggcctc
aattgtatacctgaggaaattgaagctttatcaaaattaggcatccctgcggtcctctta
ttcggtatccctaagcaaaaagacgcttgcggcagtgaatcaatgaataataatgggatc
attcaacaagcgatcaaaaaaattaaatccgttaatagtgacatgttagtgatcactgat
ctttgcttttgcgaatacaccgatcatggtcattgcggggttctggatggtagtcaaatt
aatatcgcttctaccttagagttattaggaaaacaagcagtaagtcacgctgaagcaggt
gctgactgggttgctcccagtggcatgacagacggaatggttttggctatacgccaggca
ttggatactgcctcatttcatgatattcctattttaagttacagtgccaaatattgctcg
tgcctttatgggccttttagagaggcagcgcagggtgcaccacagtttggcgataggaaa
gcgtatcaaatggatccggcaaatagtgaggaagctgtaagggaaacccgattagatctg
gaagaaggcgcagatatgattatggttaaaccagccggtttttatcttgatattatttat
aaacttaaacaacattttgctgatgtaccgctttgtgcctatcaggtcagcggtgaatat
tcgatgataaaaaatgcagcaaaaaataatctaatcaatgaagaacaagcaatgactgaa
agtctcattgcgattaaacgtgctggcgctgattttattatttcttattttgctaaaggc
atggctgagttattaaactctcaaaattttatttaa

DBGET integrated database retrieval system