KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02768Help
Entry
lpa_02768         CDS       T01232                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpa_02768 (pfkA)
   01230 Biosynthesis of amino acids
    lpa_02768 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpa_02768 (pfkA)
   00030 Pentose phosphate pathway
    lpa_02768 (pfkA)
   00051 Fructose and mannose metabolism
    lpa_02768 (pfkA)
   00052 Galactose metabolism
    lpa_02768 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    lpa_02768 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    lpa_02768 (pfkA)
Enzymes [BR:lpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lpa_02768 (pfkA)
Protein phosphatases and associated proteins [BR:lpa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     lpa_02768 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2221987..2223231
Genome map
AA seq 414 aa AA seqDB search
MSVKNAIYAQSGGVTAVINASACGVIQTAKLFPEQIGKVYAAKNGIIGALNEELIDTSLE
SEEDIAKLMQTPSGAFGSCRYKLKDNGEEYQRLIAVFKAHNIGYFFYNGGGDSQDTAHKV
SQLGKTMGYPITCIGIPKTVDNDLPFTDNCPGFGSVAKYIAISTKEAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLAEQNPGEPPHIILLPEVPFEPTRFLKKVKDCVNSYGYCVI
VVSEGIRNKEGKFLSEAGLRDAFGHAQLGGVAPVIAQLIKSELGFKYHWAVADYLQRAAR
HIASQADLDQAYALGKAAVEYAVKGYNAIMPIVIREQDEPYQWSIGQVPLAEVANQEKAM
PPEYIAEDGMGITDACKRYLSPLIQGEAYPNYKNGLPDYVRLKNQLVAKKINQD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaatgcaatctacgcccagtcgggtggtgtgaccgctgtaattaatgca
tccgcttgtggtgtcatccaaaccgccaaactatttccagagcaaattggtaaagtttat
gctgcaaaaaatggcattatcggtgccttaaacgaagaattaatcgatacttcattggaa
agtgaagaagacattgccaaattgatgcaaactccttccggagcttttggctcctgtcgc
tacaaattaaaagacaatggggaagagtatcaacgcttaatcgctgtcttcaaggcccac
aacataggctatttcttttacaatggcggcggggactcacaagatactgcccataaagta
tcccagttaggtaaaaccatgggctatcctattacctgcataggtatccctaaaacagta
gataacgatctgccttttacagacaattgcccggggtttggatcagtcgcgaaatacatt
gccatttcaacgaaggaagctggttttgatgtcgcgtccatggcggcttcatccacgaaa
gtgtttattcttgaagtgatgggaaggcatgcaggctggatagctgcggctagtgggctg
gccgagcaaaatccaggcgaaccgccacacattattctattacctgaggttccttttgag
ccaactcgttttctaaaaaaagtgaaggactgtgtcaattcatatggttattgtgtgatt
gttgtttcagaaggtatccgcaataaggaaggaaaatttctcagtgaagcaggattacgt
gacgcattcggacatgctcaattaggtggtgttgcacctgtcatcgctcaattaattaaa
tctgaactgggttttaaatatcattgggcagttgcagattatcttcaacgggcagccagg
cacatagcctcgcaagctgatttggatcaagcttacgctttaggtaaagctgctgtggaa
tatgccgttaaaggatataacgcgattatgcctattgtcattcgcgaacaagacgaaccc
tatcaatggtctataggccaagtccctctggctgaggtagctaaccaggaaaaggctatg
ccaccagagtatatagctgaagatggcatgggaattacggacgcatgcaaacgttacttg
tcccctttgattcaaggtgaagcttatccaaattacaaaaatggattgccagattatgtc
cgactaaaaaaccagttagtggctaaaaaaatcaatcaagattaa

DBGET integrated database retrieval system