KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_02954Help
Entry
lpa_02954         CDS       T01232                                 

Gene name
carA
Definition
carbamoyl-phosphate synthase small subunit (EC:6.3.5.5)
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lpa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lpa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2367048..2368160)
Genome map
AA seq 370 aa AA seqDB search
MINKSAILALADGTVYEGLSVGATGDSVGELVFNTSMTGYQEMLTDPSYARQIITLTTAH
VGNTGCNMEDMESTKVWAAGLVMRNCTAIPSNYRAEQSFPDWLSKNGVVAISGIDTRALT
LKLREKGSIGACISTNVEKPEIAVEKAKSFAGLQGADLALEVTRQTIERWHEGRGMWSLD
KQPQQLHVVAYDFGVKHNILRILHDKGCHITIVPAKTSAEEVLAMNPNGVFLSNGPGDPQ
ACDYAIKATQVFLDNNIPLFGICLGFQILALACGGITKKMKFGHHGSNHPVVETTGKKRV
FITSQNHGFAVDEDSLPNCLEVTHRSLFDNSLQGIRHKTKPAFGFQGHPEASPGPHDIDI
LFNEFVKLMK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaatcagcaattttagctttagctgatggcactgtttatgagggcctgtca
gtaggggccactggtgattctgttggtgagttggtttttaacacgtcaatgactggctat
caggaaatgcttactgatccttcgtatgccagacaaataattaccttaactactgctcat
gtgggaaatacgggttgtaacatggaggacatggagtccacaaaagtctgggcagccggc
ctcgtcatgagaaactgcactgcaatccctagcaattacagagctgaacaatctttccca
gactggttaagtaaaaatggagttgttgcaatttctggcattgatacgcgcgcgcttaca
ctgaaattgcgtgagaagggttctatcggagcttgtattagcaccaatgtggagaaacct
gaaattgctgtggaaaaggctaaatcctttgcagggcttcagggtgcggatttggcttta
gaggttacaagacaaacgatagagcgttggcatgaaggtcggggaatgtggagtctagac
aaacagcctcaacagcttcatgttgttgcttatgattttggtgtgaaacataatatttta
cgtatcttacatgataagggctgccatattactatagttcctgctaaaacttcagcagaa
gaggttttagccatgaatcctaatggtgtctttttatccaatggaccgggtgatccccaa
gcatgcgattatgccatcaaagcaacacaggtatttttagacaataatattcctttattt
ggtatatgccttgggtttcagattttggctttggcatgtggtggtattactaaaaaaatg
aaatttggacatcatggttccaatcatcctgtagttgaaacaactggcaaaaaacgtgtt
tttataacaagtcaaaatcatggttttgctgtagatgaggattcattgcccaattgcctg
gaagttacgcatcgttcattatttgataacagtttacagggaataaggcacaaaacaaaa
ccggcatttggttttcaaggccatccagaagcaagccctgggccacatgatatagatatt
ttatttaatgaatttgtaaagctgatgaaataa

DBGET integrated database retrieval system