KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_03633Help
Entry
lpa_03633         CDS       T01232                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    lpa_03633 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpa_03633 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    lpa_03633 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    lpa_03633 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lpa_03633 (adhP)
   00626 Naphthalene degradation
    lpa_03633 (adhP)
Enzymes [BR:lpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lpa_03633 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2922657..2923643
Genome map
AA seq 328 aa AA seqDB search
MHAMIMEKPGCALQYQEVNKPNPNENELLIKVSACGICRTDLHVVDGELKNPKIPLIPGH
QIVGTVEQVGSAVKQFAIGQRVGVPWLGGSCGICNFCTSGRENLCDQACFTGYQIDGGFA
EFCVANYHFCFPIPDGYPDHQAAPLFCAGLIGYRALLKVGNATHLGLYGFGAAAHILIQV
ACQKGIKIYAFTSPGDQESQKFAYRLGAVWAGDSTQSPPHLLDAAIIFAPVGALVPQALR
NIVKGGTVVCGGIHMSDIPSFPYEILWGERAVCSIANLTRKDGEEFLSLAPKIPVKTKVQ
TYPLTEVNRALDDLRHGRYRGAGVIVMK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccatgatcatggaaaagcctggatgtgcattgcaatatcaggaagtcaataaa
ccaaatccaaatgaaaatgaacttttaattaaagtatcagcttgtgggatttgtagaact
gacttgcatgttgtcgatggtgagctgaaaaatcccaagattccccttattccaggccac
caaattgtaggaactgttgaacaggttggatccgctgtgaagcaatttgcaattggacag
cgagttggagtcccttggctaggtggaagttgcgggatctgtaatttttgcacatctggc
cgagaaaatttatgtgatcaagcctgctttactggatatcaaatagatggtggtttcgct
gagttctgtgtggcaaattaccatttttgctttcctattcccgatggatacccggatcat
caggcagcaccattattttgtgcgggtttaattggatatcgtgccttgttaaaggttggt
aatgcaactcatttaggtctatatggatttggagcggcagcacatatactaattcaagtc
gcttgccaaaaaggaattaaaatttatgcgtttacaagccccggtgatcaggaatctcaa
aaatttgcataccgattaggtgctgtctgggctggggattctacgcaatcaccacctcat
cttcttgatgcagcaatcatttttgcacccgttggtgcattagtgcctcaggctcttcgc
aatattgtaaaaggaggtactgtggtttgtggtggtatacatatgtcggatattcccagc
ttcccttatgaaatactgtggggtgaacgcgctgtttgttcaattgccaatctaactcgc
aaagatggggaagagttcctgtctctggcccctaaaatcccggttaagacaaaagttcaa
acctatccccttaccgaagttaatcgagcgctggatgatttaagacatggcaggtataga
ggagccggggttattgttatgaaataa

DBGET integrated database retrieval system