KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_03851Help
Entry
lpa_03851         CDS       T01232                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lpa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lpa00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:lpa03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:lpa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lpa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3084699..3085133
Genome map
AA seq 144 aa AA seqDB search
MSPIRVDFYLLASSLPESRWLVACRLIEKAYIKGHTIFVFCDNQQQAEYLDELLWTFKDD
SFIPHNLQGEGPEPPPPVQIGYQKEPRGFTDILLNLSTNIPIFYTRFKRVIELVSNVEHE
KEVSRLHYKEYRNKGCALHTHSIE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaattcgcgttgatttttacttattagccagcagccttccagaatctcgctgg
ttggttgcttgtcgtttaatagaaaaagcctatatcaaaggacatactatttttgttttt
tgcgacaatcagcaacaagcagaataccttgatgaattattgtggactttcaaagacgac
agttttattcctcataatttgcaaggtgaaggaccagaacctcctcctcccgtacaaatt
ggctatcaaaaagaacccagaggctttacagatatcctgttgaatttatccaccaatatt
ccaattttttatacccgatttaaaagagtcattgaattggtgagtaatgtagaacatgag
aaagaagtgagtcgattgcactataaagaatataggaataaaggctgtgcattgcacaca
cactcgattgaataa

DBGET integrated database retrieval system