KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_04015Help
Entry
lpa_04015         CDS       T01232                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpa_04015 (recR)
DNA repair and recombination proteins [BR:lpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lpa_04015 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3218860..3219453
Genome map
AA seq 197 aa AA seqDB search
MDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCNNY
TEQTLCTLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDDIG
LPKLKELIIREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELEFL
DGNTISSALKNRAVINV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctaagccgcttggtagaggcgcttcgctgtcttcccggtgtgggaccaaaa
tcagcacaaaggatggtgttccatttattgcagcaccaaagacagcgaggtttacacctt
gcctcctgtttggaacaggcaatgaagcacattagtcattgccagcagtgtaataattac
actgaacaaactctgtgtactctttgccaaaaccccaatcgggattcaacattactttgc
gtggtagagagtccagcggatgtttctgccatagaacaaagcaattcctttcaaggtaaa
tattttgtccttatgggaaaaatttctcctcttgatggcttgggacctgatgacataggg
ctaccgaaacttaaggagttaattattagggaaaaaattcaggaagttattcttgcatta
agccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaaggatgaa
accgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaattttta
gatgggaatactataagcagtgcccttaagaacagagctgtgattaatgtttaa

DBGET integrated database retrieval system