KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_04062Help
Entry
lpa_04062         CDS       T01232                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
lpa00010  Glycolysis / Gluconeogenesis
lpa00051  Fructose and mannose metabolism
lpa00562  Inositol phosphate metabolism
lpa01100  Metabolic pathways
lpa01110  Biosynthesis of secondary metabolites
lpa01120  Microbial metabolism in diverse environments
lpa01130  Biosynthesis of antibiotics
lpa01200  Carbon metabolism
lpa01230  Biosynthesis of amino acids
Module
lpa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpa_04062 (tpiA)
   00051 Fructose and mannose metabolism
    lpa_04062 (tpiA)
   00562 Inositol phosphate metabolism
    lpa_04062 (tpiA)
Enzymes [BR:lpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lpa_04062 (tpiA)
Exosome [BR:lpa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lpa_04062 (tpiA)
  Exosomal proteins of bladder cancer cells
   lpa_04062 (tpiA)
  Exosomal proteins of melanoma cells
   lpa_04062 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADG26183
Position
complement(3255369..3256118)
Genome map
AA seq 249 aa AA seqDB search
MRQKIVAGNWKMNGQIQQVTELVSQIEELIGFDCAAQVAVMPPSIYIPKVRDCLRTGRIV
VGAQNVYPKDYGAYTGELSAPMLKDFDCRYVLVGHSERRQFFHEDENFVAQKFHHVKDHG
MIPILCVGETLSERENGKTEQIIAQQVLAVSAKGKDCFRDCVVAYEPVWAIGTGKTATPE
QAQKIHQFIRDLVGEINDSDAKHLTLIYGGSVNENNAKALFSMPDIDGGLVGGASLNAKQ
FVEIVKCIN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaaaagatagttgctggtaactggaaaatgaatggccagattcaacaggtgact
gaattggtttcgcaaattgaggaattaattggctttgattgcgcagcacaggttgctgta
atgcctcccagcatttatatacccaaggtaagagactgcttaaggacggggaggattgta
gtaggtgcgcaaaatgtttatccgaaagattatggtgcctacacaggtgaactgtcagct
cccatgcttaaagattttgattgccgatatgttctggtggggcactcggagcgcaggcaa
ttttttcatgaagatgaaaattttgtggcgcaaaaattccaccatgtcaaagatcatggt
atgatacctattctttgtgttggtgaaaccctttctgaaagagagaatggaaaaacagag
cagattattgctcagcaggtgctcgcagtgagtgcaaaagggaaagattgttttcgtgat
tgcgtagtggcttatgagcctgtatgggcaattgggacaggaaaaactgctacacctgaa
caggcacaaaaaatacaccagtttattagagatctggttggagaaataaatgatagcgat
gcgaaacatttgacgctcatatatggtggcagtgttaatgaaaataatgcaaaagcctta
ttttccatgccagatattgatggagggttagtgggtggagcatcgttgaatgcaaaacaa
tttgtggaaattgtgaaatgtatcaattga

DBGET integrated database retrieval system