KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_04062Help
Entry
lpa_04062         CDS       T01232                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpa_04062 (tpiA)
   01230 Biosynthesis of amino acids
    lpa_04062 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpa_04062 (tpiA)
   00051 Fructose and mannose metabolism
    lpa_04062 (tpiA)
   00562 Inositol phosphate metabolism
    lpa_04062 (tpiA)
Enzymes [BR:lpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lpa_04062 (tpiA)
Exosome [BR:lpa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lpa_04062 (tpiA)
  Exosomal proteins of bladder cancer cells
   lpa_04062 (tpiA)
  Exosomal proteins of melanoma cells
   lpa_04062 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3255369..3256118)
Genome map
AA seq 249 aa AA seqDB search
MRQKIVAGNWKMNGQIQQVTELVSQIEELIGFDCAAQVAVMPPSIYIPKVRDCLRTGRIV
VGAQNVYPKDYGAYTGELSAPMLKDFDCRYVLVGHSERRQFFHEDENFVAQKFHHVKDHG
MIPILCVGETLSERENGKTEQIIAQQVLAVSAKGKDCFRDCVVAYEPVWAIGTGKTATPE
QAQKIHQFIRDLVGEINDSDAKHLTLIYGGSVNENNAKALFSMPDIDGGLVGGASLNAKQ
FVEIVKCIN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaaaagatagttgctggtaactggaaaatgaatggccagattcaacaggtgact
gaattggtttcgcaaattgaggaattaattggctttgattgcgcagcacaggttgctgta
atgcctcccagcatttatatacccaaggtaagagactgcttaaggacggggaggattgta
gtaggtgcgcaaaatgtttatccgaaagattatggtgcctacacaggtgaactgtcagct
cccatgcttaaagattttgattgccgatatgttctggtggggcactcggagcgcaggcaa
ttttttcatgaagatgaaaattttgtggcgcaaaaattccaccatgtcaaagatcatggt
atgatacctattctttgtgttggtgaaaccctttctgaaagagagaatggaaaaacagag
cagattattgctcagcaggtgctcgcagtgagtgcaaaagggaaagattgttttcgtgat
tgcgtagtggcttatgagcctgtatgggcaattgggacaggaaaaactgctacacctgaa
caggcacaaaaaatacaccagtttattagagatctggttggagaaataaatgatagcgat
gcgaaacatttgacgctcatatatggtggcagtgttaatgaaaataatgcaaaagcctta
ttttccatgccagatattgatggagggttagtgggtggagcatcgttgaatgcaaaacaa
tttgtggaaattgtgaaatgtatcaattga

DBGET integrated database retrieval system