KEGG   Legionella pneumophila 2300/99 Alcoy: lpa_04134Help
Entry
lpa_04134         CDS       T01232                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpa  Legionella pneumophila 2300/99 Alcoy
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3325801..3326586
Genome map
AA seq 261 aa AA seqDB search
MKINDFRYMRRGKHLSELQSEEANLLAPVNQRGKGTERALLVLHGFSSSPAVYRYLIPNL
KNYDAILCPVLAGHAESIEAFSKSKAADWLQSAKNACELLINQYQKVDVLGLSLGGLLAC
QLSQSFAINHLFLLAPALKLHMRINGMLKLAQILKCLGFRQLRNAAGNLITDEHAEIAYR
KLPISTIIEMLTLAQQYKWLPPACSADLFLGIHDQVVASQQVEQLFCNLPNVKIHWLENS
AHVLPLDNDLNEIIDCINKSK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaatgattttcgttatatgcgccgcggcaaacacctcagtgaactgcagtcg
gaggaagcaaatctccttgctccagtcaatcagcgtggtaaaggcacagaacgagcttta
ctggtattgcatggtttctcttcttcaccggcagtttaccgatatctgattcctaattta
aaaaattatgatgccatcctttgccctgtattggctggtcacgccgaaagtatagaagcc
ttttcaaaatccaaagcagctgattggcttcaatcagcaaaaaacgcctgtgaactctta
ataaatcaatatcaaaaagttgatgttttagggttatctctgggaggattattagcctgt
caattaagtcaatcctttgctatcaatcacctgtttctattagctcccgcgttaaaatta
cacatgcgcatcaacggcatgctgaaattagcccagattcttaagtgcctgggatttcga
caacttcgcaacgccgcagggaatcttatcaccgatgagcatgctgaaatcgcttataga
aaactaccgatttctacaataattgaaatgctaaccttggctcagcaatataaatggctc
cctcctgcttgctcggccgatctttttcttggaattcatgatcaagtggttgcttctcaa
caagtagaacaattattttgtaatttacctaatgtaaaaatacattggttagaaaattcc
gcgcatgtattgccactggacaatgatctgaatgaaattattgattgtattaataaaagt
aagtga

DBGET integrated database retrieval system