KEGG   Lactobacillus parabuchneri: FAM21731_01216Help
Entry
FAM21731_01216    CDS       T04617                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpar  Lactobacillus parabuchneri
Pathway
lpar00071  Fatty acid degradation
lpar00072  Synthesis and degradation of ketone bodies
lpar00280  Valine, leucine and isoleucine degradation
lpar00310  Lysine degradation
lpar00362  Benzoate degradation
lpar00380  Tryptophan metabolism
lpar00620  Pyruvate metabolism
lpar00630  Glyoxylate and dicarboxylate metabolism
lpar00640  Propanoate metabolism
lpar00650  Butanoate metabolism
lpar00900  Terpenoid backbone biosynthesis
lpar01100  Metabolic pathways
lpar01110  Biosynthesis of secondary metabolites
lpar01120  Microbial metabolism in diverse environments
lpar01130  Biosynthesis of antibiotics
lpar01200  Carbon metabolism
lpar01212  Fatty acid metabolism
lpar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FAM21731_01216
   00630 Glyoxylate and dicarboxylate metabolism
    FAM21731_01216
   00640 Propanoate metabolism
    FAM21731_01216
   00650 Butanoate metabolism
    FAM21731_01216
  Lipid metabolism
   00071 Fatty acid degradation
    FAM21731_01216
   00072 Synthesis and degradation of ketone bodies
    FAM21731_01216
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FAM21731_01216
   00310 Lysine degradation
    FAM21731_01216
   00380 Tryptophan metabolism
    FAM21731_01216
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FAM21731_01216
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FAM21731_01216
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FAM21731_01216
Enzymes [BR:lpar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FAM21731_01216
Exosome [BR:lpar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FAM21731_01216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III CdiI
Motif
Other DBs
NCBI-ProteinID: APR07407
UniProt: A0A1X1FFG2
Position
complement(1263192..1264376)
Genome map
AA seq 394 aa AA seqDB search
MDKIVIIDAKRTAIGKLNGTLSSLTAEQLGTSVTSALLKSTAIRPDQIDHVIFGNAIQAG
NGQNIARQIELNSGIPENKTAYTVNQVCGSGLQAIHQAYTSLLLGETTTVIAGGTESMSN
VPYLNMSQRKATKFGPVTLYDGLQRDGLTDSSTDQPMGMTAENVADEYHVSRHEQDLFAL
RSHQRAAAAMKQNYFADEIIPLTIPQPKSKAPLTITTDESVRFDTNMEKLANLRPAFKAD
GTVTAGNSAPLNDGASALLLTTATHADSLDVKPVAEILGYAECGIDPNVMGYAPYLAINK
LLQKLEMATDDIDLFEINEAFASQSVAVIRDLDISLEKVNINGGAIALGHPLGDSGARIV
TTLIHNLKRTHQEFGIAALCMGGGMGSALAVKLI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaatcgtaattatagatgcaaagcgaaccgcgattggcaaattaaacggcact
ttatcgtcattaacagccgaacagcttggcacgtcggtgacatccgcattgctaaaaagc
accgccattcgacctgatcaaattgaccacgtcatttttggcaatgccattcaagcaggc
aacggccaaaatattgcgcgccaaatcgaactcaatagtggcattcccgaaaacaaaacg
gcttacaccgtcaaccaagtctgcggatccggcttgcaggcaatccatcaagcatacacg
tctcttctattaggagaaacaactacggtgattgccggcgggacagaaagcatgtccaac
gttccttacctcaacatgtctcaacgaaaggcaaccaaattcggcccagtcactttatac
gatggtttgcagcgtgacggcttaacagattcctcgactgaccagccaatgggcatgacc
gcagaaaatgttgccgatgaatatcacgtctcacgacacgaacaagatctgtttgccctg
cgttcacatcaacgcgccgcggctgctatgaaacaaaattactttgcggatgaaattatc
ccgctgacgattccacaaccaaaatcaaaagcgccactcacaatcaccacagatgagtcc
gttcgtttcgataccaatatggaaaaattagcaaacctccggccggcattcaaagcggac
ggaaccgttactgctggcaacagcgcccccctcaacgatggtgcttcggcgttattgctg
acgacagccactcacgcagattccttggatgtcaaaccagtcgctgaaattttgggatat
gctgagtgcggaatcgatccgaacgtgatgggatacgccccttacttggcaatcaacaag
ctgctacaaaaattagaaatggcaacggatgacattgacctttttgagattaacgaagcc
tttgcctctcaatcagttgccgttatccgcgatctcgatatttcactggagaaagtcaat
atcaacggaggcgccattgcgcttggccatcctctgggagactccggtgctcgaatcgtg
acaacactcatccacaacttaaaacgtacccaccaagaatttggaattgccgctttatgt
atgggcggtggcatgggatcagctcttgctgtaaagctcatctaa

DBGET integrated database retrieval system