KEGG   Legionella pneumophila Corby: LPC_0347Help
Entry
LPC_0347          CDS       T00532                                 

Gene name
pncA
Definition
bifunctional pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lpc  Legionella pneumophila Corby
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LPC_0347 (pncA)
Enzymes [BR:lpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     LPC_0347 (pncA)
    3.5.1.-  
     LPC_0347 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373761..374381
Genome map
AA seq 206 aa AA seqDB search
MKTLIILDVQNDFMPGGSLGVPNGDAIVPVINSILHCFDLIVASQDWHPSNHISFASNHP
GKKSFEKIKLGNLEQTLWPDHCVQGSIGAQFHAQLNTNPIEAIFRKGTDPNIDSYSGFYD
NLHKKTTGLAGYLREKGARELYFCGLCADICVYFTIKDALSQGFDCYLIEDATQALVKDD
FIKIKKELIKQGTNIINSSNLLNNLQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttaatcatcctcgatgttcaaaatgatttcatgccaggcggctcactgggg
gtaccgaatggtgatgcgattgttcccgttattaacagcattttgcattgttttgatctg
attgttgcttcacaggattggcatccttctaatcacattagtttcgcctccaatcatcct
ggtaagaaatcttttgaaaaaatcaagctggggaatttagaacaaactttatggccagat
cattgtgttcagggtagtattggagcgcaatttcatgcgcaattaaatactaatcctatt
gaagctatttttcgaaaaggaactgaccccaatatagatagctacagtggtttttatgac
aatttgcacaaaaaaaccacagggcttgccggttatctgcgcgaaaaaggcgctagagaa
ctttatttttgtggtttgtgcgctgatatttgtgtttattttacaattaaggatgccctc
agccagggatttgattgctatttgattgaggatgcaactcaagcgcttgtgaaggatgat
ttcataaaaataaaaaaagaattgataaaacaaggcactaacataattaacagttcaaat
ttgcttaataatttacaataa

DBGET integrated database retrieval system