KEGG   Legionella pneumophila Corby: LPC_0379Help
Entry
LPC_0379          CDS       T00532                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lpc  Legionella pneumophila Corby
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lpc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lpc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
412425..412916
Genome map
AA seq 163 aa AA seqDB search
MSVISLIAAIDETGGLGINNQLLCYLPADLQHFKSITMGKPIIMGRKTYESIGKPLPGRL
NIVISQSIQSIPGVVVVDSLGQAIKETTGASEVMIIGGAKIYSQAISMANRLYITRIHHQ
FTADVFFPKINELVWSCRSKEYRQHDDKNQYDMTFCIYERISI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgattagcctgatagcagccatagatgaaacaggaggattgggtattaacaac
caattactctgctatttgccagccgacttgcagcactttaaatcgattaccatgggtaag
cctattatcatgggcagaaaaacttatgaatcgataggcaaacctcttccaggcagacta
aatattgtgattagtcaatcgattcagtcaataccgggtgttgttgttgtcgattctttg
ggccaggccataaaagaaaccactggcgcatcagaggtaatgatcattggaggggccaag
atctattctcaagccatatcaatggctaatcgcttatatatcactcgaatacaccatcaa
tttacggccgatgtattttttccaaaaatcaatgaattggtatggagctgccgaagcaag
gagtatcgacagcatgatgacaaaaatcaatacgatatgacattttgcatatatgaaaga
atatcaatttga

DBGET integrated database retrieval system