KEGG   Legionella pneumophila Corby: LPC_0379Help
Entry
LPC_0379          CDS       T00532                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lpc  Legionella pneumophila Corby
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LPC_0379 (folA)
   00670 One carbon pool by folate
    LPC_0379 (folA)
Enzymes [BR:lpc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LPC_0379 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
412425..412916
Genome map
AA seq 163 aa AA seqDB search
MSVISLIAAIDETGGLGINNQLLCYLPADLQHFKSITMGKPIIMGRKTYESIGKPLPGRL
NIVISQSIQSIPGVVVVDSLGQAIKETTGASEVMIIGGAKIYSQAISMANRLYITRIHHQ
FTADVFFPKINELVWSCRSKEYRQHDDKNQYDMTFCIYERISI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgattagcctgatagcagccatagatgaaacaggaggattgggtattaacaac
caattactctgctatttgccagccgacttgcagcactttaaatcgattaccatgggtaag
cctattatcatgggcagaaaaacttatgaatcgataggcaaacctcttccaggcagacta
aatattgtgattagtcaatcgattcagtcaataccgggtgttgttgttgtcgattctttg
ggccaggccataaaagaaaccactggcgcatcagaggtaatgatcattggaggggccaag
atctattctcaagccatatcaatggctaatcgcttatatatcactcgaatacaccatcaa
tttacggccgatgtattttttccaaaaatcaatgaattggtatggagctgccgaagcaag
gagtatcgacagcatgatgacaaaaatcaatacgatatgacattttgcatatatgaaaga
atatcaatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system