KEGG   Legionella pneumophila Corby: LPC_0658Help
Entry
LPC_0658          CDS       T00532                                 

Definition
glycosyl hydrolase family transporter 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lpc  Legionella pneumophila Corby
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LPC_0658
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LPC_0658
Enzymes [BR:lpc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LPC_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1442252..1443400
Genome map
AA seq 382 aa AA seqDB search
MSLALKIKSIILSFFLVLMATVACATQVSLRDKIGQMLILGFQGKVVDEKSPIAQAIEKN
NIGGVILFDFNQQSQTFDKNIESPEQVNQLNNQLQTLTQKANRKYHRDNLPLLISVDYEG
GNVNRLHPRYGFPEMPSAKDIGSMSLERADASAELMANTLKSTGFNLNFFPELDVNINPD
NPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKHQIHCSYKHFPGHGSSLSDSHLGFVDISD
TWSEQELIPFLQLLSQPNHCDMVMIAHIVNRKLDMTGLPASLSYQIINGLLRHDLKFNGV
VITDDMQMKAITNYYGLETAVTLSINAGADMLIFGNQLVEKFQDSTEIIDMIEQKVRSGE
ISEQRINEAYQRIVKMKRSFNY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagcattgaaaatcaagtcaattattttatctttttttcttgttttgatggct
acagtagcttgcgctacacaagtgagtttgagagataaaattgggcaaatgttaatatta
ggattccagggcaaagtggttgacgagaaatcacctattgcccaggcaattgagaaaaac
aacattggtggtgttattctttttgattttaatcagcagtcacaaacttttgataaaaat
atagaaagtccggaacaagtcaaccaattaaataatcagttacaaacacttacgcaaaaa
gccaaccgtaaatatcatagagataatttaccattacttatttctgttgattacgagggg
ggaaacgttaatcgattgcatccccgttatggattccctgaaatgccttcagcaaaagac
attggctccatgtctctggaaagagctgatgcatcagcagaattgatggcaaatacttta
aaatcaacaggatttaatttgaattttttccctgaattagatgtgaatataaatccagat
aatcctatcataggcaaaaaagacaggagtttctcttcgataccggaaattgtcactcaa
tacgcgcaactttatacagagcaatttataaaacatcaaatacattgttcttataaacat
tttcctggacatggcagttcattatctgattcacatttgggttttgtagatataagtgac
acctggagcgagcaagaattaatcccttttttacaattattatctcaacccaatcattgc
gatatggtgatgatagctcatattgtgaatagaaaactggatatgacagggctacctgcc
agcctttcttaccagatcattaacggattattgcgtcatgatttaaaatttaacggggtt
gttatcaccgatgatatgcaaatgaaagcaataacgaattattatggattagaaactgct
gttactctttcaattaatgcaggagcagatatgctaatatttggtaatcaattggtagaa
aaatttcaagactcgacagaaatcattgacatgatcgagcaaaaagttcgatcgggagag
atttctgaacaaaggattaatgaagcttatcaacgaattgtaaaaatgaagaggtctttt
aattattag

DBGET integrated database retrieval system