KEGG   Legionella pneumophila Corby: LPC_0729Help
Entry
LPC_0729          CDS       T00532                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthetase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lpc  Legionella pneumophila Corby
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LPC_0729 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPC_0729 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LPC_0729 (trpB)
Enzymes [BR:lpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LPC_0729 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1511885..1513084
Genome map
AA seq 399 aa AA seqDB search
MIKKELPDEFGHFGPYGGMFVADTLVSALKQLEHAYTKYRNDQDFLSELHTELKDYVGRP
NPLYHAVHLSKKIGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQH
GVATATVAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSKTLKDALNEALR
DWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKTGRLPDALVACVGGGS
NAIGLFYPFLNDQSVMIYGVEAGGKGIETGEHSASLIAGKPGVLHGNRTYLLCDEYGQVK
DTHSVSAGLDYPGVGPEHAYLKDTGRVIYKAINDSEALDAFRLLTHTEGIIPALESSHAV
AYAIQLAKTMSKEQSIIVNLSGRGDKDMHTVAAIDGITI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagagcttccagatgagtttggccattttggcccatatggcggtatgttt
gtagccgatacattagtttctgctttaaaacaattagagcatgcctataccaaatatcgt
aacgatcaggattttctgtctgagttacacacagaattaaaagattatgtggggcggccc
aatcctctataccatgccgtacacttaagtaaaaagataggcggtgcacaaatttatctc
aagcgtgaagatttaaatcataccggcgctcataaaatcaataataccattggacaagcc
ttactcgccaaacgcatggggaaaactcgagtgatcgcggaaacaggcgcaggtcaacat
ggcgttgcaactgctacagttgccgctaaatttgggtttcaatgcgttgtgtacatgggg
tcagaagacattaagcgtcaatccagtaatgtttatagaatgaaattgttaggcgctgaa
gtggtgcctgtcacttcaggatcaaagacgttgaaagatgctttaaatgaagcattgaga
gattgggtgagtcatgtcgacgacacgttttatattattggtactgttgcaggtccccat
ccttatcctcaaatggtaagagattttcaagcgattattggtgttgaagctcgagctcag
catatggaaaaaacaggccgtttgccagatgctttggtagcttgtgtcggaggtggatcc
aatgcaataggcttgttttatccctttttgaatgatcagtctgtcatgatttatggggtt
gaagcaggagggaaaggcatagaaaccggtgagcattcagcatctctgattgctggaaaa
cctggtgtgttacacggtaatagaacctatttattgtgtgatgagtatggacaggtgaaa
gacactcattcagtatcagccggtctggattatcctggagttgggcctgaacatgcttat
ttaaaagatactggacgggtcatttataaagcaataaacgattccgaggccctggatgcc
tttcgcctgttaactcatacggaaggaattattccagcattagaatctagccacgcggta
gcctatgccatacaattggctaaaacgatgtcaaaagaacagagcatcatagtcaatcta
tctggccgtggtgataaagatatgcatacagtagctgctattgacggtataacaatttaa

DBGET integrated database retrieval system