KEGG   Legionella pneumophila Corby: LPC_0730Help
Entry
LPC_0730          CDS       T00532                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthetase, alpha chain TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lpc  Legionella pneumophila Corby
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LPC_0730 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPC_0730 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LPC_0730 (trpA)
Enzymes [BR:lpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LPC_0730 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1513110..1513928
Genome map
AA seq 272 aa AA seqDB search
MNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAE
GPVIQRAMERALAHSIHCDDVLNMVRQFRKTDNETPVILMGYLNPIEQYGYDLFAQQAVE
AGVDGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLK
GVTGSDALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGATLINEI
IEAYEAKKDPLQASGALLSSMRQAIDNIGSMV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtattgataagactctggaaaaattaaaagccaatagaaaaaaaatgttaagt
ccttatattactgcaggcgatccatatcctgagttaacagtaagtttaatgcatcaattg
gttaaatcaggggcagatgtattggagctgggaatacctttttcagaccctatggcagaa
ggtcctgttatccaaagagcaatggaacgagctttggcgcattcaattcattgcgatgac
gtattgaatatggttaggcaatttcgcaaaacggataacgaaacgcctgtgattcttatg
ggatatttaaatcctatagaacaatatggctatgatctttttgctcaacaggcagtggag
gctggggttgatgggacaatattagttgatttgcctcctgaggaagctgatggagtatcg
cgagtttggcaaaaacatggtttgtacagtatttatttatgttcgccaaccacctcagct
gaaagaatgaactttataaatcagcatgccaatggttatctgtattatgtttcattgaag
ggagtgactggttctgacgcgcttaagttgccagaattaaaagctcaatatctacaacga
aaggcacaatcaaaattaccgcttatggttgggtttggaataaaaactccggaaatggct
gcacaagttgctgaatttgctgatggggtcattgttggggcgacactgataaatgaaatc
attgaagcctatgaggccaagaaagatccgctgcaagcaagcggggctctattgagttcc
atgaggcaagctatcgataatattggaagtatggtatga

DBGET integrated database retrieval system