KEGG   Legionella pneumophila Corby: LPC_0982Help
Entry
LPC_0982          CDS       T00532                                 

Gene name
odp2
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00010  Glycolysis / Gluconeogenesis
lpc00020  Citrate cycle (TCA cycle)
lpc00620  Pyruvate metabolism
lpc01100  Metabolic pathways
lpc01110  Biosynthesis of secondary metabolites
lpc01120  Microbial metabolism in diverse environments
lpc01130  Biosynthesis of antibiotics
lpc01200  Carbon metabolism
Module
lpc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPC_0982 (odp2)
   00020 Citrate cycle (TCA cycle)
    LPC_0982 (odp2)
   00620 Pyruvate metabolism
    LPC_0982 (odp2)
Enzymes [BR:lpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LPC_0982 (odp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Bac_DNA_binding Bclx_interact
Motif
Other DBs
NCBI-ProteinID: ABQ54955
Position
1790308..1791420
Genome map
AA seq 370 aa AA seqDB search
MNIFNLPDLGEGLPDAEIHEWFVKEGDTVKADQPLVSMETAKAVVDVPCPQSGTIAKLYG
KPGDVIKTGEPLVAFVSTTEKPADKGTVVGNLEESTDVSEDNFIIGSQRSSHRVKTTPAV
RMLAKKLGVDLSSLKGSGDNGVITREDVQNQANINSQPPAGFEPLRGVRRAMLNSMVQSH
AEIVPVSIFDEADIHIWKPNTDITVRLIRAIIHASKKEPALNAWFDTKHAARRCFKEVHL
GIAMDNEEGLFVPVIHDAEKYSDSELRKIIDEFKESVRNRAVSADKLKGATITLSNFGKF
SGRFASPIIVPPMVAILAVGRLYKAAVINDEDKIEAHKMLPLSLSFDHRAITGGEATRFL
GAVIESLQQA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttttaatctacccgatttaggtgaaggtttacctgacgctgaaattcatgaa
tggtttgttaaggaaggcgacacagttaaagcagatcaacctttagtttctatggaaacg
gcaaaagcagttgttgacgtaccctgccctcaatcaggcactatcgcaaaactttatggc
aaaccaggtgacgttatcaaaacaggtgagcctcttgtagcgtttgtttcaactaccgaa
aaacctgcagataaaggcacagttgttggtaatctggaggaaagtactgatgtgtcagaa
gataattttattattggaagtcagcgttcttctcaccgcgttaagacaacacctgctgta
agaatgttagcaaaaaaattaggagttgatttaagctctttaaaaggtagtggtgacaat
ggtgttattactcgagaagatgttcaaaatcaggccaatatcaattcacaaccacctgcc
gggtttgagcccttgcgaggtgttaggcgagccatgcttaatagcatggtacaatctcat
gcagaaatagttccagtcagtatttttgatgaagcagatatccatatttggaaacccaac
acagacattactgttcgtttaatccgggctattatccatgcgtcaaaaaaggaacctgct
cttaatgcctggtttgataccaaacatgccgcacgtagatgttttaaagaagtgcatctt
ggcattgccatggacaatgaggaaggtttatttgttcctgttatccatgatgcagaaaaa
tattccgacagtgaattaagaaaaataattgatgaattcaaagaatcggttcgtaatcgg
gcggttagtgcagacaagctaaaaggggcgacaattacgctgtctaattttggaaaattt
tcaggacgttttgccagtccaataattgttcctccaatggtagcgattttagcggttgga
agactttataaagctgccgtaattaatgatgaggataaaattgaagcccacaaaatgctt
cctttatccttgagctttgatcatagggccattaccggaggcgaggccactcgattctta
ggtgccgttattgaatctttgcaacaagcatga

DBGET integrated database retrieval system