KEGG   Legionella pneumophila Corby: LPC_1036Help
Entry
LPC_1036          CDS       T00532                                 

Gene name
proB
Definition
(GenBank) glutamate-5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00330  Arginine and proline metabolism
lpc00332  Carbapenem biosynthesis
lpc01100  Metabolic pathways
lpc01130  Biosynthesis of antibiotics
lpc01230  Biosynthesis of amino acids
Module
lpc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LPC_1036 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LPC_1036 (proB)
Enzymes [BR:lpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LPC_1036 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABQ55005
Position
complement(1844045..1845115)
Genome map
AA seq 356 aa AA seqDB search
MKIIIKVGTQSILSVDGSPIYSVLNNLVNQIIYLKNLGHQVILVSSGAVGSGRKIAKNSL
GKTYGDTVGEKQLLASIGQPELMNLYSSLFKNENILVSQLLLTKQDFHTRQHYLNIARLL
TELLKHQNIIPIVNENDSVAIEELMFTDNDELAGLIAAQINADYLILLTNVDGVFTSHPN
DPESKLINTIDPNSGWPNVSAVKSKLGRGGMVSKLDTARKMAGLGINTVIANVNVESIVP
KILNREAVGTIILASKRKSSIKRWIAFSHRTSLPSIVINDNLITLLRNGNRVMSILPIGI
EDFRGECKKGDLIDILNSKNEKIGVGIARYDFLRLKDYLRLQNKPAFIHYDHLHIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattataaaagtcggaacacaaagtattttatcggtcgacggaagtccaatc
tattccgtactaaataatcttgtaaatcaaattatttatttaaagaacctggggcatcag
gtcattttagtaagctctggggctgtgggctctggtcgaaaaatagctaagaactctctg
ggaaaaacatatggtgatacagtgggagagaagcaactcttggcttcaataggccaaccc
gaactgatgaatctctattctagcttgtttaaaaatgaaaacattttagtatctcagtta
ttacttaccaaacaagacttccatactagacagcattatttaaatattgcccgtttatta
acggaattactaaagcatcaaaatattatccctattgttaatgaaaatgattcggtagcc
attgaagaattaatgtttactgataatgatgaattagcaggacttattgcagctcaaatt
aatgctgattatctaatactcttaaccaatgtcgatggtgtgtttacatcccatcccaat
gatcctgaatcaaaactcattaatacaattgaccccaattcaggttggcctaatgtctct
gctgtaaaatcaaaattaggccgaggtggtatggtgtccaaactggatactgccagaaaa
atggctggtttaggtatcaatacagtgatcgcaaatgtaaatgtagaatccattgttcca
aaaattctaaatagggaagcagttggaaccataattcttgctagtaaaagaaaatccagt
ataaaaagatggattgcttttagtcatagaacttccttaccatctatcgtaattaatgat
aatttaattaccttattacgaaatggtaatcgtgtaatgagcattttaccaatagggata
gaagattttcgtggagaatgcaaaaaaggtgatttaattgatatccttaattccaaaaat
gaaaagataggagttgggatcgccagatatgatttcttaagattaaaggactatcttaga
cttcaaaataagcctgcatttatacattacgatcatttgcatattctatag

DBGET integrated database retrieval system