KEGG   Legionella pneumophila Corby: LPC_1072Help
Entry
LPC_1072          CDS       T00532                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpc  Legionella pneumophila Corby
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LPC_1072 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPC_1072 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LPC_1072 (thrC)
Enzymes [BR:lpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LPC_1072 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1884784..1886052)
Genome map
AA seq 422 aa AA seqDB search
MKIRIKSTRGQYVSTIDEAILSGLAGDGGVFVPDRFPNLTIKKFYEYGNLIDFSVNLLSP
FFSDSKIDVNNAFFQKFLTFSFPLHHLFKKSYVLELFHGPTLSFKDLGTQFFSECLLHLI
ENKSAKVMVATSGDTGAAIAHALHGKRDLEGIILFPKDKLTFRQQSQITCWGENIRALAI
NGSFDQCQQLVKLVFAKREHKGVLTTANSMNIARLLPQIIFYAFTSIQLALRHNHSVNFI
VPGGNLGNVTACYWAKMLGFPIEQILIANNTNSALGEFLLTGAYQAKSVTKTLATAMDVG
EPSNLERLFILFNNYSECKKQMNAESVSDEQIKQAILHCYNKYHYIICPHTATAYHRLST
INQDKPWVIVAPGHPAKFEEVLEPLLNKEIPVPEQLKVFLGRKQHYSIIEPNYHSLYHFL
VE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaataaagagtacgagaggacaatatgtctccacaatagacgaagcgata
ctgtcaggcctggcaggggatggtggggtatttgtacctgacaggtttcccaatttaaca
ataaaaaaattttatgaatacggtaatttaatcgacttttctgttaatttactctcgcca
tttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctcaccttc
tcctttccgttacatcatctttttaagaaaagttatgtactggagttgtttcatggccca
accctgtctttcaaagatttaggaactcaatttttcagtgaatgtttattgcatctgata
gaaaacaagagcgccaaagtcatggtcgcaacatctggtgatactggcgctgcgattgct
catgctttgcatgggaaaagagacctggaaggaatcattttatttcccaaagataaactt
actttcagacaacaatctcaaattacttgttggggagagaatattcgtgcattggctatt
aatggcagctttgatcaatgtcaacagctggtgaagctggtatttgccaaaagagaacat
aaaggagtattgactacagccaatagcatgaatatagccagattattaccacagattatt
ttctatgcttttaccagcattcaactggcattaagacataatcattctgttaattttata
gttccaggcggaaacctgggtaatgttacggcttgttattgggcaaaaatgctgggtttt
ccgattgagcaaattttaatagctaataatactaatagtgcactgggcgaatttttgtta
acgggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggatgtaggt
gagccaagcaatttggagcgtttattcattttatttaataattattctgaatgtaaaaaa
cagatgaatgcagaatctgttagtgatgagcaaattaagcaagctatcctacattgttac
aataaatatcattatataatttgccctcataccgccacagcttatcatcgtctaagtaca
atcaatcaggacaaaccttgggttattgtggcaccagggcacccggccaaatttgaagag
gtattagagccactattgaacaaagaaattcctgtcccggaacagctgaaggtcttttta
ggcagaaaacaacattattcaattatagagccaaactatcattctttgtatcatttctta
gttgaatga

DBGET integrated database retrieval system