KEGG   Legionella pneumophila Corby: LPC_1252Help
Entry
LPC_1252          CDS       T00532                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lpc  Legionella pneumophila Corby
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lpc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2101582..2102577
Genome map
AA seq 331 aa AA seqDB search
MNEYNLPLRLSRLRKNAMSRALVRETRLHTQQLIAPLFISEYLTEAKEISAMPGQFQLGL
NCIPEEIEALSKLGIPAVLLFGIPKQKDACGSESMNNNGIIQQAIKKIKSVNSDMLVITD
LCFCEYTDHGHCGILDGTQINIAATLELLGKQAVSHAEAGADWVAPSGMTDGMVLAIRQA
LDTASFHDIPILSYSAKYCSCLYGPFREAAQGAPQFGDRKAYQMDPANSEEAVRETRLDL
EEGADMIMVKPAGFYLDIIYKLKQHFADVPLCAYQVSGEYSMIKNAAKNNLINEEQAMTE
SLIAIKRAGADFIISYFAKGMAELLNSQNFI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatataatttgcctttaagattatctcgtttaagaaaaaatgccatgtcaaga
gcattagtaagagagacgaggctgcatacacaacaactaattgctccattgtttattagc
gaatatttaactgaagcaaaagaaatcagcgctatgccaggccaatttcaactaggcctc
aattgtatacctgaggaaattgaagctttatcaaaattaggcatccctgcagtcctctta
ttcggcatccctaagcaaaaagatgcttgtggcagtgaatcaatgaataataatggaatc
atccaacaagctattaaaaaaattaaatcagtgaatagtgacatgttagtgattactgat
ctttgtttttgcgaatataccgatcatggtcattgcgggattctggatggtactcaaatt
aatattgctgctaccttagaattattaggaaaacaagcggtaagtcatgctgaagcaggt
gctgactgggttgctcccagtggcatgacagacggaatggttttggctatacgccaggca
ttggatactgcctcatttcatgatattcctattttaagttacagtgccaaatattgctcg
tgcctttatgggccttttagagaggcagcgcagggtgcaccacagtttggcgataggaaa
gcgtatcaaatggatccggcaaatagtgaggaagctgtaagggaaacccgattagatctg
gaagaaggcgcagatatgattatggttaaaccagccggtttttatcttgatattatttat
aaacttaaacaacattttgctgatgtaccgctttgtgcctatcaggtcagcggtgaatat
tcgatgataaaaaatgcagcaaaaaataatctaatcaatgaagaacaagcaatgactgaa
agtctcattgcgattaaacgtgctggcgctgattttattatttcttattttgctaaaggc
atggctgagttattaaactctcaaaattttatttaa

DBGET integrated database retrieval system