KEGG   Legionella pneumophila Corby: LPC_1314Help
Entry
LPC_1314          CDS       T00532                                 

Gene name
rnc
Definition
ribonuclease III
Orthology
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
lpc  Legionella pneumophila Corby
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2170904..2171578)
Genome map
AA seq 224 aa AA seqDB search
MKINLERLCRRLNYHFNNIAYLKQALTHCSAGSDNYERFEFLGDSILSFVIANELFNRFP
LHSEGQLSRLRSFLVKGEMLAEIAREIGLGDYLFLGQGELRSGGFRRTSILADALEAILA
AIYLDGGMTAAKQIILMLYSSRLDDPDLNHCLKDAKTQLQEFLQASKFALPEYVLTKIEG
DEHAQIFHVTCTIEGVSQVAYGTGPNRRKAEQLAAKAMLEQLQG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaatttagaaagattgtgcagacgtttaaactatcattttaataacatagcc
tatttgaagcaggctttgacgcattgcagtgctggtagcgataattatgaacgctttgag
tttcttggagactcgatattaagttttgttattgccaatgagctattcaatcgttttcca
cttcacagtgaagggcaattaagtcgattgcgctcttttcttgttaaaggtgaaatgtta
gcagaaatagccagagaaataggtttgggtgattatctatttcttgggcaaggtgagtta
aggagcggtggatttcgccgcacatctatattagcagatgcccttgaggctatattggca
gccatttatttggatggaggaatgactgctgcaaaacagattattttaatgctttatagt
tcacgattagatgatccggatttaaatcattgtttaaaggatgcaaagacacaattacag
gagtttttgcaagcatcaaaattcgctttacctgaatacgtcctaaccaagattgagggg
gatgagcacgctcaaatcttccatgtaacatgcacaattgagggagtaagtcaggtagct
tatggcacagggcctaatagaagaaaagctgagcagttggcagcaaaagccatgttggaa
cagttacaaggttaa

DBGET integrated database retrieval system