KEGG   Legionella pneumophila Corby: LPC_1367Help
Entry
LPC_1367          CDS       T00532                                 

Gene name
pfp
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lpc  Legionella pneumophila Corby
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LPC_1367 (pfp)
   01230 Biosynthesis of amino acids
    LPC_1367 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPC_1367 (pfp)
   00030 Pentose phosphate pathway
    LPC_1367 (pfp)
   00051 Fructose and mannose metabolism
    LPC_1367 (pfp)
   00052 Galactose metabolism
    LPC_1367 (pfp)
  Energy metabolism
   00680 Methane metabolism
    LPC_1367 (pfp)
Enzymes [BR:lpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LPC_1367 (pfp)
Protein phosphatases and associated proteins [BR:lpc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LPC_1367 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2226620..2227864
Genome map
AA seq 414 aa AA seqDB search
MSVKNAIYAQSGGVTAVINASACGVIQTAKLFPEQIGKVYAAKNGIIGALNEELIDTSLE
SEEDIAKLMQTPSGAFGSCRYKLKDNGEEYQRLIAVFKAHNIGYFFYNGGGDSQDTAHKV
SQLGKTMGYPITCIGIPKTVDNDLPFTDNCPGFGSVAKYIAISTKEAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLAEQNPGEPPHIILLPEVPFEPIRFLKKVKDCVNSYGYCVI
VVSEGIRNKEGKFLSEAGLRDAFGHAQLGGVAPVIAQLIKSELGFKYHWAVADYLQRAAR
HIASQVDLDQAYALGKAAVEYAVKGYNAIMPIVIREQDEPYQWSIGQVPLVEVANQEKAM
PPEYIAEDGMGITDACKRYLSPLIQGEAYPNYKNGLPDYVRLKNQLVAKKINQD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaatgcaatctacgcccagtctggtggtgtgaccgctgtaattaatgca
tccgcttgtggtgtcatccaaaccgccaaactatttccagagcaaattggtaaagtttat
gctgcaaaaaatggcattatcggtgccttaaacgaagaattaatcgatacttcattggaa
agtgaagaagacattgccaaattgatgcaaactccttccggagcttttggctcctgccgc
tacaaattaaaagacaatggggaagagtatcaacgcttaatcgctgtcttcaaggcccac
aacataggctatttcttttacaatggcggcggggactcacaagatactgcccataaagta
tcccagttaggtaaaaccatgggctatcctattacctgcataggtatccctaaaacagta
gataacgatctgccttttacagacaattgcccggggtttggatcagtcgcgaaatacatt
gccatttcaacgaaggaagctggttttgatgtcgcgtccatggctgcttcctccacgaaa
gtatttattcttgaagtaatgggaaggcatgcaggctggatagctgcggctagtgggctg
gcagagcaaaatccaggcgaaccgccacacattattctattgcctgaggtaccttttgaa
ccaattcgttttctaaaaaaagtgaaggactgtgtgaattcatatggttattgtgtgatt
gttgtttcagaaggtatccgcaataaggaaggaaaatttctcagtgaagcaggattacgt
gatgcatttggacatgctcagttaggtggtgttgcaccagtcatcgcccaattaattaaa
tctgaactgggttttaaataccattgggcagtggcagattatcttcaacgagcagccagg
cacatagcctcgcaagttgatttggatcaagcttacgctttaggtaaagctgctgtggaa
tatgccgttaaaggatataacgcgattatgcctattgtcattcgtgaacaagacgaaccc
tatcaatggtctataggtcaagtccctctggttgaggtagctaaccaggaaaaggctatg
ccaccagaatatatagctgaagatggcatgggaattacggacgcatgcaaacgttacttg
tcccctttgattcaaggtgaagcttatccaaattacaaaaatggattgccagattatgtc
cgactaaaaaaccagttagttgctaaaaaaatcaatcaagattaa

DBGET integrated database retrieval system