KEGG   Legionella pneumophila Corby: LPC_1783Help
Entry
LPC_1783          CDS       T00532                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
lpc  Legionella pneumophila Corby
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LPC_1783 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    LPC_1783 (bdhA)
Enzymes [BR:lpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     LPC_1783 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2731533..2732315
Genome map
AA seq 260 aa AA seqDB search
MKLKNKIAIVTGAASGIGKEIALVYAKEGAKVAIADLNLDQASHVAEEIKSSGGQAMAVA
MNVTDEAQVNQGVDKVADHFGGVDVLVSNAGIQIIESVDKLAFSDWKRMLAIHLDGAFLT
TKACLKYMYASGNGGSIIYMGSVHSKEASVLKAPYVTAKHGLLGLCKVVAKEGGTHKVRA
NVICPGFVRTPLVDKQIPEQAKELGISEEDVIKKVMLKETVDGEFTTTDDVAQTALFFAS
FESNALTGQSLVVSHGWFME
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaagaataaaatcgctattgtcacaggagcagcaagcggaattggtaaagaa
attgcgcttgtttatgctaaagaaggggcaaaggtagcaatcgctgatctgaatcttgat
caggcaagccatgtagcagaggaaatcaaatcatcaggcggacaagcaatggctgttgcc
atgaatgtaactgatgaagcacaagtcaatcagggcgtggataaagtagctgatcacttt
ggaggagttgatgttttagtcagcaatgccggtattcaaatcatcgaatcagtagataaa
ttagccttttcagactggaaaagaatgcttgccattcatttggatggtgcctttttaact
actaaagcttgcttgaaatacatgtatgcctcaggcaatggcggcagtattatttatatg
ggctcggtccattcaaaagaagcctctgtactcaaagcaccttatgttactgccaaacat
ggtctattgggtttatgcaaagtagttgccaaggaaggtggaactcataaggtaagggcc
aatgtcatttgcccgggctttgtccgtactcctctcgttgacaaacaaattccagagcaa
gcaaaagaattaggcatcagtgaagaagatgtcatcaagaaagtgatgctaaaagaaaca
gttgacggggaattcaccacaacagacgatgtagcacaaaccgctttattttttgcatca
tttgaatcgaatgcgcttacaggacaatcattggtagtcagtcatggttggttcatggag
taa

DBGET integrated database retrieval system