KEGG   Legionella pneumophila Corby: LPC_1984Help
Entry
LPC_1984          CDS       T00532                                 

Gene name
adhT
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lpc  Legionella pneumophila Corby
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LPC_1984 (adhT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPC_1984 (adhT)
  Lipid metabolism
   00071 Fatty acid degradation
    LPC_1984 (adhT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LPC_1984 (adhT)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LPC_1984 (adhT)
   00626 Naphthalene degradation
    LPC_1984 (adhT)
Enzymes [BR:lpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LPC_1984 (adhT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2986137..2987123
Genome map
AA seq 328 aa AA seqDB search
MHAMIMEKPGCALQYQEVNKPNPNENELLIKVSACGICRTDLHVVDGELKNPKIPLIPGH
QIVGTVEQVGSAVKQFAIGQRVGVPWLGGSCGICNFCTSGRENLCDQACFTGYQIDGGFA
EFCVANYHFCFPIPDGYPDHQAAPLFCAGLIGYRALLKVGNATHLGLYGFGAAAHILIQV
ACQKGIKIYAFTSPGDQESQKFAYRLGAVWAGDSTQSPPHLLDAAIIFAPVGALVPQALR
NIVKGGTVVCGGIHMSDIPSFPYEILWGERAVCSIANLTRKDGEEFLSLAPKIPVKTKVQ
TYPLTEVNRALDDLRHGRYRGAGVIVMK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccatgatcatggaaaagcctggatgtgcattgcaatatcaggaagtcaataaa
ccaaatccaaatgaaaatgaacttttaattaaagtatcagcttgtgggatttgtagaact
gacttgcatgttgtcgatggtgagctgaaaaatcccaagattccccttattccaggccac
caaattgtaggaactgttgaacaggttggatccgctgtgaagcaatttgcaattggacag
cgagttggagtcccttggctaggtggaagttgcgggatctgtaatttttgcacatctggc
cgagaaaatttatgtgatcaagcctgctttactggatatcaaatagatggtggtttcgct
gagttctgtgtggcaaattaccatttttgctttcctattcccgatggatacccggatcat
caggcagcaccattattttgtgcgggtttaattggatatcgtgccttgttaaaggttggt
aatgcaactcatttaggtctatatggatttggagcggcagcacatatactaattcaagtc
gcttgccaaaaaggaattaaaatttatgcgtttacaagccccggtgatcaggaatctcaa
aaatttgcataccgattaggtgctgtctgggctggggattctacgcaatcaccacctcat
cttcttgatgcagcaatcatttttgcacccgttggtgcattagtgcctcaggctcttcgc
aatattgtaaaaggaggtactgtggtttgtggtggtatacatatgtcggatattcccagc
ttcccttatgaaatactgtggggtgaacgcgctgtttgttcaattgccaatctaactcgc
aaagatggggaagagttcctgtctctggcccctaaaatcccggttaagacaaaagttcaa
acctatccccttaccgaagttaatcgagcgctggatgatttaagacatggcaggtataga
ggagccggggttattgttatgaaataa

DBGET integrated database retrieval system