KEGG   Legionella pneumophila Corby: LPC_2257Help
Entry
LPC_2257          CDS       T00532                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lpc  Legionella pneumophila Corby
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPC_2257 (deoA)
Enzymes [BR:lpc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     LPC_2257 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227433..1228947
Genome map
AA seq 504 aa AA seqDB search
MSKKTAHGLRLKHLGIKTYHEAIIYMREDCHVCHSEGFEVQTRIQVTLGQHSIIATLNVV
TSELLAPGEAGLSDYAWDALHAKEGDEIQVSHPKPLESLSYVHTKIYGNELSYEQMKVII
DDVLSGRLSDVQISAFLAASSAGRLTRTEIMKLTKAMIDSGDRLSWSSPLVVDKHCVGGL
PGNRTTLIVVPIVAAFGLMIPKTSSRAITSPAGTADTMETLAPVHLSPQKMRQVVEQENG
CIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVASILSKKIATGATHAVIDIPVGPTAKV
RNQSMALLLKQSLEEVGNELGLVVHTILTDGSQPVGHGIGPSLEARDVMSVLQGLPDAPN
DLRERALTLAGAALECSSKVQPGLGKSIAKQILESGKAFKKFQAICEAQGGMRELTKARF
THPVVAAKEGKVSLIDNRKLAKIAKLAGAPKSKSAGIDLHAHVGESVEQGEPLFTIHSES
SGELNYACDLLRDKQDIIILGENS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaaaccgctcatgggcttcgtttaaagcatttagggattaaaacctaccat
gaggccattatttacatgcgcgaggattgtcatgtttgtcattcggaaggattcgaagta
cagacccgtatccaagtgactttaggtcagcactctattatagccacccttaatgtggtg
acctcagagcttctagctccaggggaagctggtttgtcagattatgcctgggatgcttta
catgccaaagaaggcgatgaaattcaagtttcccatccaaaacccttggaatccctaagc
tatgtgcataccaagatttatggcaatgaactgtcttatgaacaaatgaaggtcatcatt
gatgatgtgttaagcggtcgtctttctgatgtacaaatctccgcttttttagcggcaagt
agtgcaggacgtctaacccgtacggaaatcatgaaactcaccaaagccatgatagacagt
ggtgatcgcttatcctggtcttcacctctggtcgtcgataaacattgcgtgggaggattg
ccgggaaatcgcacaactctgattgtagttcccattgtggccgcttttggattgatgatt
ccaaaaacatcatcacgtgccattacatcacccgcggggactgcggataccatggagact
ttagctccagtccacttaagtccccaaaagatgcgccaagtggttgaacaagaaaacggc
tgtatcgtctggggtggggctgtgagtttaagtcctgctgatgacgtgctcatccgtgtg
gaacgagccattgatttagatagtgaagggcaattagtggcgtccattctttctaaaaaa
attgcaacaggtgctacgcatgcagtcattgatatccccgtaggacctactgccaaagtc
aggaatcagtctatggcgctccttctgaaacaatcgcttgaggaggtaggtaacgagtta
ggattggttgtccatacgatattgaccgatgggtcgcagccggtaggacatggcattggc
ccgtcgttagaagctcgcgatgtaatgtcagtattacaagggttgcctgatgcccccaat
gatttgcgtgaacgagcgttgacgcttgcaggtgctgcattagagtgttcttcgaaagtt
caaccgggtttagggaaatccattgcgaaacaaatattggagagtgggaaagcgtttaaa
aaatttcaggccatttgtgaggcccagggtgggatgagggaattgaccaaggcacgtttt
actcatcctgttgtggctgcaaaggaaggaaaagtctccctcattgacaatcgaaagctt
gcaaaaatagctaagcttgctggtgcgccaaaatcgaaatcggcgggtattgacctccat
gcccatgtcggcgaatccgttgaacaaggcgaacctttgtttacaattcattcggagtcc
tcaggggagctcaattacgcttgtgatttacttcgcgataaacaagacatcattatttta
ggagaaaattcttga

DBGET integrated database retrieval system