KEGG   Legionella pneumophila Corby: LPC_2448Help
Entry
LPC_2448          CDS       T00532                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lpc  Legionella pneumophila Corby
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpc00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lpc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1028211..1029479
Genome map
AA seq 422 aa AA seqDB search
MDKLLINGGKALHGEVVISGAKNAALPIMAASLLASDHVTISNVPHLKDITTMMELLGQL
GAHLIVDEKMNVQVDSSQVNEFVAPYDLVKTMRASILVLGPMLARFGKADVSLPGGCAIG
TRPVDLHLKALRAMGADITVKNGYINARCKKGRLQGKRLMFDTVTVTGTENVLMAAVLAE
GITTIKNAAREPEVVDLANFLIQMGAKIRGAGTSTIEVEGVESLNGGTYSVMSDRIEAGT
YLAAGALTRGQVTVKKVRPDTLLSQLCKFEEAGAELTIGEDWVSLNMHNKRPEAVNISTA
PYPAFATDMQAQFMAMNSVAEGSSTIVETIFENRFMHVQELQRMGANIQLNGNTAIVHGV
EKLTGAPVMATDLRASASLILAGLVAEGETVVERIYHVDRGYERIEEKLSLLGADIKRVS
DR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggataaattattgattaatggtggtaaagcattacatggtgaagtggtcatttcggga
gcaaaaaacgctgctcttccaatcatggctgccagtctattagccagtgatcacgtcaca
atatctaatgtacctcatcttaaagacatcactaccatgatggaactgttagggcaattg
ggagctcatttaattgttgatgaaaagatgaatgttcaagttgactccagtcaagtcaat
gagtttgttgctccttacgatctggtcaaaacaatgcgtgcctccattttggtattaggc
ccaatgctggcgcgcttcggtaaggcagatgtttctttgcccggtggatgcgccattgga
acaagaccagttgacctgcatttaaaagcattaagagccatgggggcagacattacggtt
aaaaatggctacatcaatgctcgttgcaaaaagggacgtctgcaaggtaaacgcttgatg
tttgacacagttactgtcacaggaaccgaaaatgtgttaatggctgctgtgttggcagaa
ggcattactacgattaaaaatgctgcgcgtgaaccagaagtagtggacttggctaacttt
ctgattcaaatgggagcgaaaattcgaggcgcgggtacttcaactattgaagtagagggt
gtggagtcactaaacggggggacttattcagtcatgtccgatagaatagaagcgggcact
tatttggcagctggagcgcttactcgtggtcaagtgactgttaagaaagtacgtcctgat
actttattatctcaattatgtaaattcgaagaggcaggcgcggaattaaccattggtgag
gattgggttagtttaaatatgcataacaaacgtcctgaagcagtgaatatttctaccgct
ccttaccctgcatttgcaacggatatgcaagctcaatttatggcaatgaattctgtagca
gaaggttcatcaactattgtagaaactatttttgaaaaccgattcatgcacgttcaagag
ttacagagaatgggagctaatattcaactcaatggaaatacagccatcgttcatggtgtt
gaaaaattaactggcgcaccggtaatggctactgatttaagggcatcagccagtttaatt
ctcgcgggcctggttgctgaaggggaaacagtagtcgagcggatttatcatgttgataga
ggttatgagcgaatagaagaaaagttatctctattgggagcggacattaagagagtttct
gacaggtga

DBGET integrated database retrieval system