KEGG   Legionella pneumophila Corby: LPC_2594Help
Entry
LPC_2594          CDS       T00532                                 

Gene name
pcm
Definition
protein-L-isoaspartate-O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lpc  Legionella pneumophila Corby
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(874011..874661)
Genome map
AA seq 216 aa AA seqDB search
MNHSARINMIKQQLRTGDVLNESILDLYDEILRHEFVPEPFSHFAYSDMQIPLAHGQRML
TPLEEGTILQSLDLKGHETVLEVGTGTGFMTALLSKLCKKVISIDYYSEFTTNAKRKLEE
HNCNNVELITGDACRGWLESAPYDVIVFTGAMEKLTDTHKLQILPGGKLFAILGKSPVMK
AYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacagcgcacgcataaatatgatcaaacaacagttacgaactggtgatgtatta
aacgaatccatccttgacttatacgatgagatcttaagacatgagtttgttcctgaacct
ttttctcattttgcttattcagacatgcaaattcctttggcacacggtcaaaggatgtta
actccattggaagaaggtacaattttacaatcccttgatcttaaaggccatgaaaccgtg
ttggaagtgggaacaggaaccggttttatgaccgctttactcagtaagttatgtaaaaaa
gtgatcagtattgactattattctgaatttactaccaatgcaaaacgcaaacttgaagag
cataattgtaataatgttgaattaattaccggagatgcttgtcgtggatggttggaaagt
gcaccatacgatgttatcgtattcactggtgccatggaaaagctgacagatacccataaa
ctacaaattttacctggtggcaagttattcgcaatccttggtaaatcccctgtaatgaaa
gcttatctttttcagttggatcataatgcaatctggacagaatccatgctttttgaaacg
gatatacctcctctggtagatcaattgaaaccgaaagaatttgttttctag

DBGET integrated database retrieval system