KEGG   Legionella pneumophila Corby: LPC_2715Help
Entry
LPC_2715          CDS       T00532                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00240  Pyrimidine metabolism
lpc00250  Alanine, aspartate and glutamate metabolism
lpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPC_2715 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LPC_2715 (pyrB)
Enzymes [BR:lpc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LPC_2715 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Sigma70_r1_1 Hydrolase DUF3271
Motif
Other DBs
NCBI-ProteinID: ABQ56626
UniProt: A5IGX6
Position
714660..715553
Genome map
AA seq 297 aa AA seqDB search
MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYENSTRTRISFELAERH
LSMSVVNLDLQTSSETKGEAIEDTIRTLAAMGIQYFVIRHKQDGLQQNLANKLGDTVHII
NAGDGTHAHPSQAILDMVTIVEQKKQLDKLKIAILGNIKHSRVANSFQCICSKLGVGELV
LISPEIWQPSQVHFGRVTDNLNEGLEGADVIICLRVQRERLLQDDHLDLDFYRNNFALTQ
KSLSYAKPDAMVMHPGPMNRGVEIDSEVADGKQSCILQQVTNGVYARMAILESLIGS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattttcttgaaattagtcaattgtcatctgaacaaattgaatccttattgcaa
cgagctttatactttaaacacacaaaacaatacccttcttattcccaaagtattattgct
aatttattttatgaaaacagtaccagaacccggatcagttttgagttagcagagcgccat
ctgtcaatgtctgtagtgaatctggatcttcagacctcatcagaaactaaaggcgaagcc
attgaagacaccatcagaacgctagccgctatgggtatccagtattttgtaattcgccat
aagcaagatgggctgcagcaaaatttagctaataagttaggtgatacagttcatataata
aatgctggtgatggaactcatgcacatccaagccaagcgatactggatatggtgacaatt
gttgaacaaaaaaagcaattagacaaattaaaaattgctattttgggaaatatcaaacat
tcacgtgttgctaattctttccaatgcatttgcagtaaattaggggttggtgagttggtt
ttgatttctccggagatttggcaaccatcacaagtgcactttggacgggttactgataat
ctcaatgaaggtctggaaggtgcggatgtgataatttgtctgcgagttcaaagggaacgt
ttgctgcaagatgatcatttggatttggatttttatagaaacaattttgcacttactcaa
aaaagtctgtcttatgcaaaacctgacgctatggttatgcaccctgggcctatgaatcgc
ggggttgaaattgatagtgaagtggctgatggcaagcaatcttgtattttacaacaggtt
actaacggtgtttatgcaagaatggctattcttgaatcgctgataggaagttga

DBGET integrated database retrieval system