KEGG   Legionella pneumophila Corby: LPC_2741Help
Entry
LPC_2741          CDS       T00532                                 

Definition
stearoyl-CoA-9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpc  Legionella pneumophila Corby
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lpc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lpc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689322..690509
Genome map
AA seq 395 aa AA seqDB search
MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHPVISHFFRFWLWLTTG
MVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYREARKDRDMVAKYSHGTP
TDWIERNVYSRHSSKGILLMLLLDLFFFGIPGITVWAIQMMWIPLFAAGVINGIGHYWGY
RNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWWEFDIGWMYIRILSFFGLA
KVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSNYYKNVIRPILKYEKNTSIETKEDK
KLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYSYKQSLQNVWLKTATTQKELV
EALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtattcggctttttaaacttgtctttctggggatatgttcttgcaacttttatcctg
actcaaatcacaattgcatctgttactatctatcttcatcggaaccagactcatagagcg
ctaacattacatcctgtgatcagtcattttttccgtttttggttatggttaactacgggt
atggttactgcggattgggttgctatccaccgcaagcaccatgcaacaactgatgttgag
ggagaccctcatagcccagtggttgagggaatcagaaaggtattttggcaaggcgctgaa
ctttacagagaggcacgcaaggacagggatatggttgccaaatattctcatggcacacca
actgattggatagagcgtaatgtctactcgcgccattcaagcaaaggtattttgctgatg
ttattactggatttatttttcttcgggattcctggaatcacagtatgggcaatccaaatg
atgtggattccgctgtttgctgcgggagtcatcaatggcatcggccattattggggatac
aggaattttgaatgccctgatgccgctactaatatcattccctggggattttggattggt
ggagaagagttacataataatcatcacacttttgcttcctcagccaaattttcagtgaaa
tggtgggagtttgatattggttggatgtatattcgcattctttcctttttcggtttggcc
aaggtaaaaaaattacctcccaaattggctatggatgaaggaaaattccatgttgatctg
gatactgtgagagcagttatttcaaatcgctttcaagtgatgtctaattactataagaat
gtcatcagacctattttgaagtatgaaaaaaataccagcattgagacaaaagaagacaag
aaattgtttcaacgggcaggtagattactgcgtcgagaggataagttattatcgacaaaa
gctaaaactcgtttgcaaaaactgctcgatgcccgcgaacagttgagagtggtttactct
tacaagcaatcattacaaaatgtttggctgaaaacagcaacgactcaaaaagaattagta
gaagctctgcagcaatggtgccgccaggcagaggaatcgggtcttgatgtgctgaaacag
tttgctcaacaattgaaaggctacgtaccggtatatactagggagtga

DBGET integrated database retrieval system