KEGG   Legionella pneumophila Corby: LPC_2773Help
Entry
LPC_2773          CDS       T00532                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
lpc  Legionella pneumophila Corby
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LPC_2773 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LPC_2773 (sdhD)
   00650 Butanoate metabolism
    LPC_2773 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    LPC_2773 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660127..660474
Genome map
AA seq 115 aa AA seqDB search
MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNFSQWHLLFANKIFQIA
TTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLGQFIWGLMIIWGQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtcaccagcttaacaggaaatgggttaaaggattggttaattcaaaga
gttacagctgtctattttgcagcctatttaatttttttatttggatttatattggcaaat
cctgatttaaatttttctcaatggcatcttttgtttgccaataagatatttcaaattgca
acaacaattgggttgatggctttaacattgcatgcctggataggtatttggacagtaact
acagattatatgaaatgtactgttatacgtttatcagtacagttattggttgttttatgg
ctccttggtcaatttatctggggccttatgatcatttggggacaatag

DBGET integrated database retrieval system