KEGG   Legionella pneumophila Corby: LPC_2921Help
Entry
LPC_2921          CDS       T00532                                 

Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
lpc  Legionella pneumophila Corby
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LPC_2921
Enzymes [BR:lpc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LPC_2921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(514320..515603)
Genome map
AA seq 427 aa AA seqDB search
MIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPNYYYDWIRDSAIAMGL
VETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPKFYINGNPFDGEWGRPQ
NDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDPQSMGTIKMDLEYIAHHWQDANF
DLWEEVYGHHFFTAMAQQKALTDGAILARQLHDRQAAVFYEMQANLINSRLQQHLDHQNK
IIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHTFVRNTAKALHEQFNLMFPI
NKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYFTMAHNLSLNSSNKLHIQN
YLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLREQLENRIK
TMGWNTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattttttttgtctctcaaactatggcttcagtatttacccatgaagaggttcaaata
ttaaaaaaacattttttaaataactttcaaaccaatggagccatcgtagcctcaccctcg
caatacaatcccaattattattatgactggattcgagactctgccattgccatgggattg
gttgagacatggtatgaagccagccaatctgctcgatataaaaaacttttattagaatac
gtttcatggacagaaaaaatacagcatcaagcggatcccattgctggccaggatatattg
ggtgaacccaaattttatatcaatggcaatccttttgatggggaatggggacgaccacaa
aatgatggtccggcactcagagcatctgttttaattcgttttgcgcaacagcttctcgat
cataatgaaatagattatgtcaaatcacatctttataacaacaccatggacccacaatcc
atgggcactatcaagatggatttggaatacatcgcgcatcattggcaagatgcaaatttt
gacctgtgggaagaggtttatggccatcattttttcacggctatggcacaacaaaaagcg
ctgaccgatggcgccattttggctcgccaacttcatgacagacaagctgctgttttttat
gaaatgcaagccaacttaattaacagtcgactgcaacagcatttggaccatcagaataaa
ataattcaagccacattattacctcaccctggtcctcaaaaaacactagagcttgattcg
tccgtcatgttgggtattttaactaatccacaaaaagaaggtgtttttgccccacatcac
acctttgtgcgaaatactgcaaaggctttgcatgagcaatttaatttgatgtttcctatt
aataaaaaccgttctggagcaatattgtttggtcgttatcctggcgatacttatgatggc
tatcaaacaaacagcataggaaacccctggtttatcttaacagctacgatggctgaatat
tattttaccatggctcataatctgtccctgaacagcagtaataaacttcatatacagaac
tatctaaagaaaggggacaattacctaaggctgataaaacaatatggccctgatctgaat
ttaagtgaacaaattaatttgaataccggagttcagcaaggagcgacatccttgacctgg
agttacgtttccgtcttgcgagctattcatttaagagagcaattggaaaatagaataaaa
actatgggctggaatacctattag

DBGET integrated database retrieval system