KEGG   Legionella pneumophila Corby: LPC_2924Help
Entry
LPC_2924          CDS       T00532                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00010  Glycolysis / Gluconeogenesis
lpc00052  Galactose metabolism
lpc00500  Starch and sucrose metabolism
lpc00520  Amino sugar and nucleotide sugar metabolism
lpc00521  Streptomycin biosynthesis
lpc01100  Metabolic pathways
lpc01110  Biosynthesis of secondary metabolites
lpc01120  Microbial metabolism in diverse environments
lpc01130  Biosynthesis of antibiotics
lpc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPC_2924 (glk)
   00052 Galactose metabolism
    LPC_2924 (glk)
   00500 Starch and sucrose metabolism
    LPC_2924 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LPC_2924 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LPC_2924 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LPC_2924 (glk)
Enzymes [BR:lpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LPC_2924 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABQ56825
Position
511051..512046
Genome map
AA seq 331 aa AA seqDB search
MMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCAEFISLESALLTYKNRHSLQ
EIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEVLEVMNDFTAIAMSLPVLSTQ
DLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSAFAGEGGHADWGAKTEQEWFIY
RYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEFLSAAQIISLALNQECFIAHKAV
AQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSLVHQSDFRIQFEDKGRFSDFNALI
PTYVIAAAQPGILGASVSLKQILTGASHVLF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctcatgatttagcgcagtatgcgattgttgcggacataggcggtacttttgct
cgtttcagtagagttaatcttgtcaatttgcagatggataaaattgaaatttctccttgt
gccgagtttattagtcttgagtccgcgctattaacttataaaaaccggcattctttgcaa
gaaataaaacatattgcgatagcgattgcgtgtccagtcatcgatgatttggtttctatg
acgaattgtcattggcaattttcaataacagagttaaaacagagacttggccttgaagtt
ctggaagtcatgaatgattttactgcgattgcgatgagtttacctgtattatcgactcag
gatctggtgcagattggtaatggttacctggatgccagtaaagtgagagtggtgttaggc
gcaggaaccggtttgggtgttgcttatttaattcctcatcaacatcactatagtgctttt
gcaggggaaggggggcatgctgattggggagcaaaaactgagcaggaatggtttatctat
cgttatttaaaaagtaaatactcccatgtatcttatgagcgtttgctgtctggtcaagga
ctggaaaatttatatcaagctttagccgcgtatcatagtaaaaaagttgaatttttgtca
gcagcgcaaattatatctttggcattaaatcaggaatgtttcatagctcataaggcagta
gcccaatttttttcaagtttgggatcgtttgctggtgatttagcattaacttatggagct
tttggtggtgtttatattgcaggagggattatgccgcgtttgctctccttggtacaccaa
agcgactttagaatccaatttgaagacaaaggacgatttagtgattttaatgccttaatt
cccacttatgtcattgcagccgctcaaccaggtattttaggcgcgagcgtcagtttaaaa
caaatattgacaggagcttctcatgtccttttctga

DBGET integrated database retrieval system