KEGG   Legionella pneumophila Corby: LPC_2924Help
Entry
LPC_2924          CDS       T00532                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lpc  Legionella pneumophila Corby
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LPC_2924 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPC_2924 (glk)
   00052 Galactose metabolism
    LPC_2924 (glk)
   00500 Starch and sucrose metabolism
    LPC_2924 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LPC_2924 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LPC_2924 (glk)
   00524 Butirosin and neomycin biosynthesis
    LPC_2924 (glk)
Enzymes [BR:lpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LPC_2924 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511051..512046
Genome map
AA seq 331 aa AA seqDB search
MMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCAEFISLESALLTYKNRHSLQ
EIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEVLEVMNDFTAIAMSLPVLSTQ
DLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSAFAGEGGHADWGAKTEQEWFIY
RYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEFLSAAQIISLALNQECFIAHKAV
AQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSLVHQSDFRIQFEDKGRFSDFNALI
PTYVIAAAQPGILGASVSLKQILTGASHVLF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctcatgatttagcgcagtatgcgattgttgcggacataggcggtacttttgct
cgtttcagtagagttaatcttgtcaatttgcagatggataaaattgaaatttctccttgt
gccgagtttattagtcttgagtccgcgctattaacttataaaaaccggcattctttgcaa
gaaataaaacatattgcgatagcgattgcgtgtccagtcatcgatgatttggtttctatg
acgaattgtcattggcaattttcaataacagagttaaaacagagacttggccttgaagtt
ctggaagtcatgaatgattttactgcgattgcgatgagtttacctgtattatcgactcag
gatctggtgcagattggtaatggttacctggatgccagtaaagtgagagtggtgttaggc
gcaggaaccggtttgggtgttgcttatttaattcctcatcaacatcactatagtgctttt
gcaggggaaggggggcatgctgattggggagcaaaaactgagcaggaatggtttatctat
cgttatttaaaaagtaaatactcccatgtatcttatgagcgtttgctgtctggtcaagga
ctggaaaatttatatcaagctttagccgcgtatcatagtaaaaaagttgaatttttgtca
gcagcgcaaattatatctttggcattaaatcaggaatgtttcatagctcataaggcagta
gcccaatttttttcaagtttgggatcgtttgctggtgatttagcattaacttatggagct
tttggtggtgtttatattgcaggagggattatgccgcgtttgctctccttggtacaccaa
agcgactttagaatccaatttgaagacaaaggacgatttagtgattttaatgccttaatt
cccacttatgtcattgcagccgctcaaccaggtattttaggcgcgagcgtcagtttaaaa
caaatattgacaggagcttctcatgtccttttctga

DBGET integrated database retrieval system