KEGG   Legionella pneumophila Corby: LPC_3039Help
Entry
LPC_3039          CDS       T00532                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lpc  Legionella pneumophila Corby
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lpc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3283384..3283977
Genome map
AA seq 197 aa AA seqDB search
MDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCNNY
TEQTLCTLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDDIG
LPKLKELIIREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELEFL
DGNTISSALKNRAVINV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctaagccgcttggtagaggcgcttcgctgtcttcccggtgtgggaccaaaa
tcagcacaaaggatggtgttccatttattgcagcaccaaagacagcgaggtttacacctt
gcctcctgtttggaacaggcaatgaagcacattagtcattgccagcagtgtaataattac
actgaacaaactctgtgtactctttgccaaaaccccaatcgggattcaacattactttgc
gtggtagagagtccagcggatgtttctgccatagaacaaagcaattcctttcaaggtaaa
tattttgtccttatgggaaaaatttctcctcttgatggcttgggacctgatgacataggg
ctaccgaaacttaaggagttaattattagggaaaaaattcaggaagttattcttgcatta
agccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaaggatgaa
accgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaattttta
gatgggaatactataagcagtgcccttaagaacagagctgtgattaatgtttaa

DBGET integrated database retrieval system