KEGG   Legionella pneumophila Corby: LPC_3050Help
Entry
LPC_3050          CDS       T00532                                 

Definition
(GenBank) hypothetical protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
lpc  Legionella pneumophila Corby
Pathway
lpc00790  Folate biosynthesis
lpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LPC_3050
Enzymes [BR:lpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     LPC_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABQ56940
Position
3293892..3294431
Genome map
AA seq 179 aa AA seqDB search
MEKLYSNLLKELGEDINREGLKDTPGRAANALRYLTKGYNENLDEIINGALFDSDMSEMV
IVKDIELYSLCEHHLLPFLGKCHVGYLPDGKVIGLSKIARIVDFYARRLQIQERLTGEIA
HCIESITGARGVAVVIEAKHLCMMMRGVEKQNSVMTTSVMLGEMRNNSSCRLEFLNLIR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattatactcaaatttgcttaaagaattaggcgaagatataaatcgggaagga
ttaaaggatactcctggacgagcagctaatgccttacgttatttaactaaaggttacaat
gagaaccttgatgaaatcattaacggtgctctgtttgattcagacatgagtgaaatggtt
atcgtcaaggacatagaactgtactcattatgcgaacatcacttattgccttttttgggc
aaatgtcatgttggatatctacctgatggtaaagtaataggcttatctaaaattgctcgt
attgttgatttttatgcgaggagactacaaattcaagaacggctgactggcgaaattgct
cattgtattgaatccattaccggagctcgcggtgtcgccgtagtgattgaagcaaaacat
ctttgcatgatgatgcgtggagttgaaaaacagaattctgtcatgacaacttcagttatg
ctcggtgaaatgcgtaacaattcgagttgccgtttggaattcttaaatttaatccgttaa

DBGET integrated database retrieval system