KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0245Help
Entry
lp12_0245         CDS       T01726                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lp12_0245
   00330 Arginine and proline metabolism
    lp12_0245
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    lp12_0245
Enzymes [BR:lpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     lp12_0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289200..290132
Genome map
AA seq 310 aa AA seqDB search
MSSKLLTIQLLEELVHAAELNQEGKTADYIPELANVNQELTAIAVQALGEKTLAYSNNPL
HPVTLQSTGKMIPLIGLLEEFGADQLFEWVKVEPSGDDFASITRLEQFGPKPSNPMLNAG
AIALCSRIPGIGEQQFRWLEHWVQKLFNQRLSINPLVFASEKRTGNRNRALAYLLKSRNN
LGADVHETLDLYFALCSYEAMLDQMLYLPTLLANRGKDPDTGEQILSTETCKITLAIMAT
CGLYDETGTHMVKTGMPAKSGVSGYTIAVVPGKAGIVVLSPRVNAKGNSIRGEIMLEGLS
KAMNWHFALP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaaattgcttaccatccaattgttagaagagcttgtgcatgctgccgaatta
aatcaagaaggcaaaaccgcggattatatccctgaactggcgaatgttaatcaggaattg
acggcaattgcggtgcaagctttgggtgagaaaaccttggcttatagtaataatccactt
catccagtgactttgcaaagcacggggaagatgattcctttgattggtttgcttgaagag
tttggcgccgatcaattatttgaatgggttaaggtggagccctcaggtgatgatttcgct
tccattacccgcctggagcagtttggacctaaaccgtcaaatcccatgttgaacgctggc
gctattgctttatgctcacgcattcctggcataggtgaacagcaatttagatggctagag
cattgggtacaaaaattatttaatcaacgtctcagtattaatcctctggtttttgcctct
gaaaaacgaaccggtaatcgtaaccgcgctcttgcttatttactgaaaagcagaaacaat
cttggagctgatgttcatgaaaccctcgatttgtattttgcgctatgttcctatgaagcc
atgttggatcagatgctgtacttacctactttgttagctaatagagggaaagatccggac
acgggtgaacaaatactgtctacggaaacctgtaaaattactttagccattatggcgact
tgcgggttatatgatgaaacaggtactcacatggttaaaacagggatgccagctaaaagt
ggagtatctggttataccatcgcggttgttcccggtaaagcaggtattgtggtattgagt
ccaagagtgaatgcgaaaggaaatagcatacgaggtgaaatcatgctggaaggtttatcc
aaagcaatgaattggcatttcgcattaccttaa

DBGET integrated database retrieval system