KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0253Help
Entry
lp12_0253         CDS       T01726                                 

Definition
stearoyl CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    lp12_0253
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    lp12_0253
Enzymes [BR:lpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     lp12_0253
Lipid biosynthesis proteins [BR:lpe01004]
 Desaturase
  First
   lp12_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(299665..300864)
Genome map
AA seq 399 aa AA seqDB search
MSFCQLHNFRHLRGGMMFGFLNMTLWGYLLAGFVLTHITTTAVTIYLHRYQTHRALTLHP
LVSHFFRFWLWLTTGMTTAEWVAIHRKHHANTDMEGDPHSPQVFTLKKVFWQVPELYREA
SKDKDMIKKYSSGTPNDWIERKLYSPHANKGIFLMLTLNLFLFGIPGLTLWAIQMMWIPL
VAGVVNGIGHYWGYRNHESSDSSTNVFPWGLLIAGEELHNNHHTFASSAKFSIKWWEFDL
GWFYIRCLSFLKLAKVKKLPPKLIIDKNKSHIDVDSVKAILGNRFQVISDYYKLVIFPTL
RDMQYRIKNRDLKNARHLFKKPNEQLSHADQLRLKTLLKQHDNLQAVHNYRELLQQIWLK
TSLSNKDLLNLIQKWCSQAEESGLHVLRQFASQLKSYSL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atatcgttttgccaattacacaatttcaggcacctaagaggaggaatgatgtttggtttt
ttaaatatgactttatggggatatcttttggccggttttgtcctgactcacatcaccacc
actgctgttaccatttacttacatcgttatcaaacacaccgcgcattaactctgcatcct
cttgtaagccattttttccgcttctggctttggttaacgaccgggatgaccacggcagaa
tgggtagccattcatcggaaacatcatgccaatactgacatggaaggggatccacatagc
cctcaggtatttactttaaaaaaagtattttggcaagttccagaattatatcgagaggcc
tctaaagataaagacatgattaaaaaatactcctcgggcactccaaacgactggatagag
cgcaaattatattctccccatgcgaacaaaggcatatttttaatgctcacacttaatctt
ttcttgtttggaattcctggacttaccctttgggcaatccaaatgatgtggatacctctt
gttgctggcgtggtcaatggaatagggcactattggggttatcgcaatcatgagtcgtca
gattcttcaaccaatgtttttccctggggtttattgattgctggtgaagaattgcataat
aatcatcataccttcgcctcctcagccaaattttccattaaatggtgggaatttgatttg
ggttggttttacatacgttgtttgtcttttttaaagcttgccaaagtaaaaaaattaccc
ccaaaactgatcattgacaagaataaatctcatatagatgtagattcggtaaaagcgata
cttggtaatcgctttcaagtgatatctgattattacaagctggttatatttcctactctg
cgcgatatgcaataccgcataaaaaatcgggatttaaagaatgctcgccatttattcaag
aaaccgaacgaacagctatcccatgctgatcagttgcgattgaaaacattacttaagcaa
catgacaacttgcaagcggttcataattaccgcgaattattacagcagatatggttaaaa
acgtccctatccaataaggatcttcttaatttaatacaaaaatggtgtagccaggccgaa
gaatccgggctgcatgtgttaaggcaatttgcatcacaattaaaaagctattctctctga

DBGET integrated database retrieval system