KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0253Help
Entry
lp12_0253         CDS       T01726                                 

Definition
stearoyl CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lpe01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lpe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(299665..300864)
Genome map
AA seq 399 aa AA seqDB search
MSFCQLHNFRHLRGGMMFGFLNMTLWGYLLAGFVLTHITTTAVTIYLHRYQTHRALTLHP
LVSHFFRFWLWLTTGMTTAEWVAIHRKHHANTDMEGDPHSPQVFTLKKVFWQVPELYREA
SKDKDMIKKYSSGTPNDWIERKLYSPHANKGIFLMLTLNLFLFGIPGLTLWAIQMMWIPL
VAGVVNGIGHYWGYRNHESSDSSTNVFPWGLLIAGEELHNNHHTFASSAKFSIKWWEFDL
GWFYIRCLSFLKLAKVKKLPPKLIIDKNKSHIDVDSVKAILGNRFQVISDYYKLVIFPTL
RDMQYRIKNRDLKNARHLFKKPNEQLSHADQLRLKTLLKQHDNLQAVHNYRELLQQIWLK
TSLSNKDLLNLIQKWCSQAEESGLHVLRQFASQLKSYSL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atatcgttttgccaattacacaatttcaggcacctaagaggaggaatgatgtttggtttt
ttaaatatgactttatggggatatcttttggccggttttgtcctgactcacatcaccacc
actgctgttaccatttacttacatcgttatcaaacacaccgcgcattaactctgcatcct
cttgtaagccattttttccgcttctggctttggttaacgaccgggatgaccacggcagaa
tgggtagccattcatcggaaacatcatgccaatactgacatggaaggggatccacatagc
cctcaggtatttactttaaaaaaagtattttggcaagttccagaattatatcgagaggcc
tctaaagataaagacatgattaaaaaatactcctcgggcactccaaacgactggatagag
cgcaaattatattctccccatgcgaacaaaggcatatttttaatgctcacacttaatctt
ttcttgtttggaattcctggacttaccctttgggcaatccaaatgatgtggatacctctt
gttgctggcgtggtcaatggaatagggcactattggggttatcgcaatcatgagtcgtca
gattcttcaaccaatgtttttccctggggtttattgattgctggtgaagaattgcataat
aatcatcataccttcgcctcctcagccaaattttccattaaatggtgggaatttgatttg
ggttggttttacatacgttgtttgtcttttttaaagcttgccaaagtaaaaaaattaccc
ccaaaactgatcattgacaagaataaatctcatatagatgtagattcggtaaaagcgata
cttggtaatcgctttcaagtgatatctgattattacaagctggttatatttcctactctg
cgcgatatgcaataccgcataaaaaatcgggatttaaagaatgctcgccatttattcaag
aaaccgaacgaacagctatcccatgctgatcagttgcgattgaaaacattacttaagcaa
catgacaacttgcaagcggttcataattaccgcgaattattacagcagatatggttaaaa
acgtccctatccaataaggatcttcttaatttaatacaaaaatggtgtagccaggccgaa
gaatccgggctgcatgtgttaaggcaatttgcatcacaattaaaaagctattctctctga

DBGET integrated database retrieval system