KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0534Help
Entry
lp12_0534         CDS       T01726                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lp12_0534
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lp12_0534
   00650 Butanoate metabolism
    lp12_0534
  Energy metabolism
   00190 Oxidative phosphorylation
    lp12_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
573679..574026
Genome map
AA seq 115 aa AA seqDB search
MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLSFSQWHLLFTNKAFQIA
TTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLTQFIWGLMIIWGQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtcaccagtttaacaggaaatgggttaaaggattggttaattcaacga
gttaccgctgtctattttgcagcctatttaatttttttgtttggatttatattggcaaat
cctgatttaagtttttctcaatggcatcttttgtttactaacaaggcatttcaaattgca
acaacaattggattgatggctttgacattgcatgcctggataggtatttggacagtaact
acagattatatgaaatgtactgttatacgtttatcagtgcagttattagttgttttgtgg
ctccttactcaatttatctggggccttatgatcatttggggacaatag

DBGET integrated database retrieval system