KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0538Help
Entry
lp12_0538         CDS       T01726                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:lpe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lpe00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:lpe00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
579436..580665
Genome map
AA seq 409 aa AA seqDB search
MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL
FNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKSTSPVVR
RMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKANQTAEVQKEPSMRALSFGGREE
KRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSFEKKHGVKLGFMS
FFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVVPVIRDADQLSMAEIE
LAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPPQTGILGMHKIEERPI
VEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRLLLNV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaagtcaaagtacctgttctacccgagtcagtagctgatgcaacagtggct
gcgtggcataagaaagtgggtgataaagtatctcgcgatgagaacctagtggatctggaa
acagataaagttgtgcttgaagttccatcacctgtggatggggtattgtctgacattctg
tttaataccggagatacggttggttcaggagacttactggcaaaaatttctcaaagtgtt
tctgtagaatctcaaaaaactgagaaagaagagaaacctgtcaaaaaagaagaaataaaa
atttccgaaagtgaatcagttagcacaaaagaagataaatcaaccagtccggtagtaaga
cggatgatggctgaaaatgatttgaaagccgggcagattcaaggtaccggtaaagatggc
aggataaccaaagaagacgttttatcttatatagaatctaatagagaaaaagcaaaccaa
accgctgaagttcaaaaagaaccttctatgagagcactttcctttggcggcagggaagaa
aaacgtgtccctatgacgagactaagagccaagattgcggaacgtttactacaagcacaa
cacaacgctgccatgttaaccacttttaacgaagtgaatttgaaggcagttatggacatg
cgttctcagtataaggatagttttgaaaaaaaacatggtgtaaaacttggatttatgtct
tttttcacaaaagcagtagtagagtcgctgaaacgattcccggccgtgaatgcttccatt
gatgggcaagatattgtttatcatggtttttatgatataggaattgctgtttctactgaa
agaggtttagttgttccggtaattagagacgctgatcaattaagcatggcagaaattgaa
ttagccattaatgatgcggcatcaaaagccagaaccggtaagctgtctatggaagagatg
caagggggaacatttaccataaccaacggtggagtattcggttcattattagctactccc
attatcaacccaccgcaaacaggtatcttggggatgcataaaattgaggaaagacctatt
gtagagaaagggcaaatagtaatccgtcctatgatgtatgttgctttgtcttatgatcat
cgtttaattgatggaaaagattctgtacaatttttagtaagtgttaaagagttgttggaa
gatccgtctcgacttttacttaatgtttaa

DBGET integrated database retrieval system