KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0538Help
Entry
lp12_0538         CDS       T01726                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
lpe00020  Citrate cycle (TCA cycle)
lpe00310  Lysine degradation
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01120  Microbial metabolism in diverse environments
lpe01130  Biosynthesis of antibiotics
lpe01200  Carbon metabolism
Module
lpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lp12_0538
  Amino acid metabolism
   00310 Lysine degradation
    lp12_0538
Enzymes [BR:lpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     lp12_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEW50815
UniProt: G8USU2
Position
579436..580665
Genome map
AA seq 409 aa AA seqDB search
MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL
FNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKSTSPVVR
RMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKANQTAEVQKEPSMRALSFGGREE
KRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSFEKKHGVKLGFMS
FFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVVPVIRDADQLSMAEIE
LAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPPQTGILGMHKIEERPI
VEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRLLLNV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaagtcaaagtacctgttctacccgagtcagtagctgatgcaacagtggct
gcgtggcataagaaagtgggtgataaagtatctcgcgatgagaacctagtggatctggaa
acagataaagttgtgcttgaagttccatcacctgtggatggggtattgtctgacattctg
tttaataccggagatacggttggttcaggagacttactggcaaaaatttctcaaagtgtt
tctgtagaatctcaaaaaactgagaaagaagagaaacctgtcaaaaaagaagaaataaaa
atttccgaaagtgaatcagttagcacaaaagaagataaatcaaccagtccggtagtaaga
cggatgatggctgaaaatgatttgaaagccgggcagattcaaggtaccggtaaagatggc
aggataaccaaagaagacgttttatcttatatagaatctaatagagaaaaagcaaaccaa
accgctgaagttcaaaaagaaccttctatgagagcactttcctttggcggcagggaagaa
aaacgtgtccctatgacgagactaagagccaagattgcggaacgtttactacaagcacaa
cacaacgctgccatgttaaccacttttaacgaagtgaatttgaaggcagttatggacatg
cgttctcagtataaggatagttttgaaaaaaaacatggtgtaaaacttggatttatgtct
tttttcacaaaagcagtagtagagtcgctgaaacgattcccggccgtgaatgcttccatt
gatgggcaagatattgtttatcatggtttttatgatataggaattgctgtttctactgaa
agaggtttagttgttccggtaattagagacgctgatcaattaagcatggcagaaattgaa
ttagccattaatgatgcggcatcaaaagccagaaccggtaagctgtctatggaagagatg
caagggggaacatttaccataaccaacggtggagtattcggttcattattagctactccc
attatcaacccaccgcaaacaggtatcttggggatgcataaaattgaggaaagacctatt
gtagagaaagggcaaatagtaatccgtcctatgatgtatgttgctttgtcttatgatcat
cgtttaattgatggaaaagattctgtacaatttttagtaagtgttaaagagttgttggaa
gatccgtctcgacttttacttaatgtttaa

DBGET integrated database retrieval system