KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0539Help
Entry
lp12_0539         CDS       T01726                                 

Definition
(GenBank) succinyl CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
lpe00020  Citrate cycle (TCA cycle)
lpe00640  Propanoate metabolism
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01120  Microbial metabolism in diverse environments
lpe01130  Biosynthesis of antibiotics
lpe01200  Carbon metabolism
Module
lpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lp12_0539
   00640 Propanoate metabolism
    lp12_0539
   00660 C5-Branched dibasic acid metabolism
    lp12_0539
Enzymes [BR:lpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     lp12_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEW50816
UniProt: G8USU3
Position
580672..581892
Genome map
AA seq 406 aa AA seqDB search
MFNCKARLDGSCFFKKVIRMNLHEYQAKQLFASYDLPVPRGEVAYNVEDALLVASQLSTS
RWVVKAQVHAGGRGKAGGVKLVSSKDELAAVAKSMLGTRLVTYQTDARGQPVNAILVEET
CEIDKELYLGAVVDRSTRRVVIMASTEGGVEIEKVAHETPEKIFKVVVDPLVGVMPFQCR
ETAFKLGLKDDQIKQFTHLMMGLGKMFVECDLSLLEINPLVITKSGQLICLDGKINIDGN
ALFRQPKLKNMRDVSQEDDRENRASDWELNYIPLDGTIGCMVNGAGLAMATMDVIKLHGG
EPANFLDVGGGATKERVSEALKIIVSDEKVKGILVNIFGGIVRCDLIADGILAAVKEVDV
KIPVVVRLEGNNAQLGAEILNKSNLNVIAATSLTDAAKKIVAAVSE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactgcaaggcccgtcttgacgggtcttgcttttttaaaaaggtaattagaatg
aatttacatgaatatcaagccaagcaattattcgcgagctatgatttaccagttcctcgt
ggtgaggtcgcttataatgttgaggatgccttgctcgttgcttctcaattatcaacctct
cgctgggttgtgaaagcacaagtccatgctggtggtagaggtaaagctggtggggtgaaa
ctggtttctagcaaggatgaattggctgcagttgcgaaatccatgttaggtacacgcttg
gttacctatcaaactgatgccagaggccaaccggttaatgctattttggttgaagaaacc
tgcgaaatagacaaggaattatatctcggtgctgttgttgatagatccaccagacgagtt
gttattatggcctctacagaaggtggtgttgaaattgaaaaggttgctcatgaaacacct
gaaaaaattttcaaggtggttgttgacccattagttggtgttatgccctttcaatgtcgt
gaaacagcttttaaacttggattaaaagacgatcaaatcaaacagttcactcatttgatg
atgggattagggaaaatgtttgttgagtgtgatttaagtctattagagataaatccgctt
gtcataacaaaatcagggcaactaatttgtctggatggaaaaattaatatcgatggaaat
gctttattccgacagcctaaactgaaaaatatgcgagatgtttctcaggaagatgatcga
gaaaatcgtgccagtgattgggagcttaattatattcctttggatgggacaataggttgc
atggtaaatggtgctggtttggctatggctaccatggacgtgataaaattacatggtggt
gagccggctaatttcctggatgttgggggaggcgccacaaaagaaagagtcagtgaagct
ttgaagattattgtgtcagatgaaaaagtcaaaggaattctagttaatatttttggtggt
atcgttcgttgtgaccttattgctgatggaattcttgctgctgtaaaagaagtggatgta
aaaattcctgttgttgtcagactggaaggtaataatgcccagttaggtgctgagatattg
aataaaagcaatttgaatgtgattgctgcaacgagtttgacagacgcagccaagaaaatt
gtagcagcagtttccgaataa

DBGET integrated database retrieval system