KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0539Help
Entry
lp12_0539         CDS       T01726                                 

Definition
succinyl CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:lpe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lpe00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lpe00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580672..581892
Genome map
AA seq 406 aa AA seqDB search
MFNCKARLDGSCFFKKVIRMNLHEYQAKQLFASYDLPVPRGEVAYNVEDALLVASQLSTS
RWVVKAQVHAGGRGKAGGVKLVSSKDELAAVAKSMLGTRLVTYQTDARGQPVNAILVEET
CEIDKELYLGAVVDRSTRRVVIMASTEGGVEIEKVAHETPEKIFKVVVDPLVGVMPFQCR
ETAFKLGLKDDQIKQFTHLMMGLGKMFVECDLSLLEINPLVITKSGQLICLDGKINIDGN
ALFRQPKLKNMRDVSQEDDRENRASDWELNYIPLDGTIGCMVNGAGLAMATMDVIKLHGG
EPANFLDVGGGATKERVSEALKIIVSDEKVKGILVNIFGGIVRCDLIADGILAAVKEVDV
KIPVVVRLEGNNAQLGAEILNKSNLNVIAATSLTDAAKKIVAAVSE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactgcaaggcccgtcttgacgggtcttgcttttttaaaaaggtaattagaatg
aatttacatgaatatcaagccaagcaattattcgcgagctatgatttaccagttcctcgt
ggtgaggtcgcttataatgttgaggatgccttgctcgttgcttctcaattatcaacctct
cgctgggttgtgaaagcacaagtccatgctggtggtagaggtaaagctggtggggtgaaa
ctggtttctagcaaggatgaattggctgcagttgcgaaatccatgttaggtacacgcttg
gttacctatcaaactgatgccagaggccaaccggttaatgctattttggttgaagaaacc
tgcgaaatagacaaggaattatatctcggtgctgttgttgatagatccaccagacgagtt
gttattatggcctctacagaaggtggtgttgaaattgaaaaggttgctcatgaaacacct
gaaaaaattttcaaggtggttgttgacccattagttggtgttatgccctttcaatgtcgt
gaaacagcttttaaacttggattaaaagacgatcaaatcaaacagttcactcatttgatg
atgggattagggaaaatgtttgttgagtgtgatttaagtctattagagataaatccgctt
gtcataacaaaatcagggcaactaatttgtctggatggaaaaattaatatcgatggaaat
gctttattccgacagcctaaactgaaaaatatgcgagatgtttctcaggaagatgatcga
gaaaatcgtgccagtgattgggagcttaattatattcctttggatgggacaataggttgc
atggtaaatggtgctggtttggctatggctaccatggacgtgataaaattacatggtggt
gagccggctaatttcctggatgttgggggaggcgccacaaaagaaagagtcagtgaagct
ttgaagattattgtgtcagatgaaaaagtcaaaggaattctagttaatatttttggtggt
atcgttcgttgtgaccttattgctgatggaattcttgctgctgtaaaagaagtggatgta
aaaattcctgttgttgtcagactggaaggtaataatgcccagttaggtgctgagatattg
aataaaagcaatttgaatgtgattgctgcaacgagtttgacagacgcagccaagaaaatt
gtagcagcagtttccgaataa

DBGET integrated database retrieval system