KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0562Help
Entry
lp12_0562         CDS       T01726                                 

Definition
formamidopyrimidine DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lpe03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(600825..601649)
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETTKQGIKPHLEGRMITAVQVRNRKLRLPVPLNLNELCQGKHITAITRRGKYI
LLHMDKGYLLIHLGMSGHLRIVSQTANPQKHDHVDLHINNGLALRFCDPRRFGLFIYIDE
NPYQHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDSQIVVGIGNIYAAESLFL
AKIHPNTSAKKITTEEFNSLTGHIKKILESAIEAGGTTLRDFYSSDGKPGYFRFALKVYG
RKNLPCLVCENKIETVVIAGRHSAFCPHCQPIIT
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagtcgaaacaacaaagcaaggtattaaaccccatcttgaaggc
cgtatgattaccgcagtgcaagtgcgtaatcgaaaacttagattaccagtacctctaaac
ctgaatgaattatgccaaggaaagcatataacagctattacccgtagaggaaaatacatc
ttacttcatatggataaaggttatcttctcatccatcttggaatgtccggacatttgcgt
atcgtatcccagacagcaaatcctcaaaaacatgatcatgttgatctgcacattaataat
gggcttgctctcagattctgcgatcctagaagatttggcttatttatttacattgatgaa
aatccttaccaacacccactgctggcacatttaggcccggaacctctgtctgatgacttt
aatagcgagtacttattacgtaaagctgcgaataaatcgcaatccatcaagtcatttatt
atggatagtcaaattgttgtcgggatagggaatatttatgcggcagagagtctttttctt
gccaaaatccatccaaatacctctgcaaaaaagataactacagaagaattcaattctctg
actggtcacatcaaaaagatacttgaatctgccatagaggctggagggacgacacttcgt
gatttctattcttctgatggtaaaccagggtactttcgttttgctttaaaggtttatggc
aggaaaaatctcccctgtttggtatgtgaaaataaaatagaaactgtcgtgattgccggg
cgccactccgcattttgcccacattgccagccaatcattacataa

DBGET integrated database retrieval system