KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0593Help
Entry
lp12_0593         CDS       T01726                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    lp12_0593
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lp12_0593
Enzymes [BR:lpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     lp12_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
625733..626626
Genome map
AA seq 297 aa AA seqDB search
MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYENSTRTRISFELAERH
LAMSVVNLDLQTSSETKGEAIEDTIRTLAAMGIQYFVIRHKQDGLQQNLANKLGDTVNII
NAGDGTHAHPSQAILDMVTIIEQKKRLDKLKIAILGNIKHSRVANSFQCICSKLGVGELV
LISPEIWQPSQVHFGRVTDNLNEGLEGADVVICLRVQKERLLQDDHLDLDFYRNNFALTQ
KSLSYAKPDAMVMHPGPMNRGVEIDSEVADGNQSCILQQVTNGVYARMAILESLIAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattttcttgaaattagtcaattgtcatctgaacaaattgaatccttattgcaa
cgagctttatattttaaacatacaaagcaatacccttcttattcccaaagtattattgct
aatttattttatgaaaacagtacccgaacccgcatcagctttgagttagcagagcgccat
ctggcaatgtctgtagtgaatctggatcttcagacctcatcagaaactaaaggcgaagcc
attgaagataccatcagaacgctagccgctatgggtatccagtattttgtaattcgccat
aagcaagatgggctgcagcaaaatttagctaataagttaggtgatacagttaatataata
aatgcaggtgatggaactcatgctcatccaagccaagcgatactggatatggtgacaatt
attgaacaaaaaaagcgattagataaattaaaaattgctattttgggaaatattaaacat
tcacgtgttgctaattctttccaatgcatttgcagtaaattaggggttggtgagttggtt
ttgatttctccagagatttggcaaccatcacaagtgcactttggacgggttactgataat
ctcaatgaaggtctggaaggtgcggatgtggtaatttgcctgcgagttcaaaaggaacgt
ttgctgcaagatgatcatttggatttggatttttatagaaacaattttgcacttactcaa
aaaagtctgtcttatgcaaaacctgacgctatggttatgcaccctgggcctatgaatcgc
ggggttgaaattgatagtgaagtggctgatggcaaccaatcttgtattttacaacaggtt
actaacggtgtttatgcaagaatggctatccttgaatcgctgatagcgagttag

DBGET integrated database retrieval system