KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0593Help
Entry
lp12_0593         CDS       T01726                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
lpe00240  Pyrimidine metabolism
lpe00250  Alanine, aspartate and glutamate metabolism
lpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    lp12_0593
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lp12_0593
Enzymes [BR:lpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     lp12_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Sigma70_r1_1 Hydrolase DUF3271
Motif
Other DBs
NCBI-ProteinID: AEW50864
UniProt: G8USZ1
Position
625733..626626
Genome map
AA seq 297 aa AA seqDB search
MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYENSTRTRISFELAERH
LAMSVVNLDLQTSSETKGEAIEDTIRTLAAMGIQYFVIRHKQDGLQQNLANKLGDTVNII
NAGDGTHAHPSQAILDMVTIIEQKKRLDKLKIAILGNIKHSRVANSFQCICSKLGVGELV
LISPEIWQPSQVHFGRVTDNLNEGLEGADVVICLRVQKERLLQDDHLDLDFYRNNFALTQ
KSLSYAKPDAMVMHPGPMNRGVEIDSEVADGNQSCILQQVTNGVYARMAILESLIAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattttcttgaaattagtcaattgtcatctgaacaaattgaatccttattgcaa
cgagctttatattttaaacatacaaagcaatacccttcttattcccaaagtattattgct
aatttattttatgaaaacagtacccgaacccgcatcagctttgagttagcagagcgccat
ctggcaatgtctgtagtgaatctggatcttcagacctcatcagaaactaaaggcgaagcc
attgaagataccatcagaacgctagccgctatgggtatccagtattttgtaattcgccat
aagcaagatgggctgcagcaaaatttagctaataagttaggtgatacagttaatataata
aatgcaggtgatggaactcatgctcatccaagccaagcgatactggatatggtgacaatt
attgaacaaaaaaagcgattagataaattaaaaattgctattttgggaaatattaaacat
tcacgtgttgctaattctttccaatgcatttgcagtaaattaggggttggtgagttggtt
ttgatttctccagagatttggcaaccatcacaagtgcactttggacgggttactgataat
ctcaatgaaggtctggaaggtgcggatgtggtaatttgcctgcgagttcaaaaggaacgt
ttgctgcaagatgatcatttggatttggatttttatagaaacaattttgcacttactcaa
aaaagtctgtcttatgcaaaacctgacgctatggttatgcaccctgggcctatgaatcgc
ggggttgaaattgatagtgaagtggctgatggcaaccaatcttgtattttacaacaggtt
actaacggtgtttatgcaagaatggctatccttgaatcgctgatagcgagttag

DBGET integrated database retrieval system