KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0769Help
Entry
lp12_0769         CDS       T01726                                 

Definition
dTDP-6-deoxy-D-glucose-3,5-epimerase RmlC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    lp12_0769
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lp12_0769
Enzymes [BR:lpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     lp12_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833458..834042
Genome map
AA seq 194 aa AA seqDB search
MSTGINYMKVINTKIPEVKIIEPKIYGDERGFFYESFQAKRYEELLGITDRFVQDNFSRS
QKGVLRGLHYQSQQTQGKLVSVLAGEVFDVAVDIRLGSPTFGQWVGVILSGENKRQFWIP
KGFAHGFYVLSAMADFAYKCTDYYHPESEFSIHYLDPQLAIDWPLGEQVQLSPKDAAAKL
LNLIDAELLPRYQA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atttctaccggcattaactacatgaaagttataaatacaaaaatccctgaagtaaaaatt
attgaacccaagatttatggtgatgaaaggggttttttttatgaatcttttcaagctaaa
cgatatgaagagttattaggaataactgatcgttttgtacaagataatttttcaagatca
caaaaaggggtactaagaggtttgcattatcaaagtcaacaaacccagggaaaactggtt
tcagttttagctggtgaagtgtttgatgttgccgtggatattaggttaggctcccctact
tttgggcaatgggttggagtgattctttccggagaaaacaaaaggcaattttggattcct
aaagggtttgctcatgggttttatgttttgagtgctatggctgatttcgcttataaatgt
accgactattatcatcctgaaagtgagttttctattcattatcttgatccgcaattagca
attgattggccattaggagagcaggttcaattgtctccaaaagatgctgcagccaagctt
ttaaatttaatagatgctgaacttttaccgagatatcaagcctaa

DBGET integrated database retrieval system