KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0855Help
Entry
lp12_0855         CDS       T01726                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp12_0855
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp12_0855
Enzymes [BR:lpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     lp12_0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(932510..933286)
Genome map
AA seq 258 aa AA seqDB search
MNSILERIAKHKLEEVAVAKKNKPLHVLSKQQPGEIRDFITALKSNTSPAVIAEIKKASP
SKGLIRKDFNVAEIAKIYTQNGARCLSVLTDIEFFQGHPDYLALAKSKTTLPVLRKDFII
DSYQIYESLVLGADCILLIVALLDDVQLMDFCQLAQELKMSVLVESHTQDELERALRLPT
PLIGINNRSLHNFKTDIQLSIQLKQLVPKDKIIITESGINTREDIKLMQSHGINAFLIGE
SLMRADNIGKALQELMAN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtatcctggaacgaatagccaaacataaactagaagaagttgcagttgcgaaa
aaaaataagcctttacatgttctgtcaaaacaacagccaggggaaatacgtgacttcata
actgctttaaaatccaatacctcacctgcagtcatagctgagataaaaaaggcttctcca
agcaaaggtttaattcgaaaagattttaatgttgcagaaattgccaagatttatacccaa
aatggcgcaagatgcttatctgttttaacggatattgagttttttcaaggtcatcctgat
tatttggctttggcaaaatcaaaaactactttgcccgtattgcgtaaagactttattatt
gattcttatcaaatctatgaaagccttgtcttaggcgctgattgtattttactcattgtc
gccttattagatgatgttcaattaatggatttttgccaactggctcaagaacttaaaatg
tctgttttggttgaaagtcacacgcaagatgagttagaaagagcattacgcttacccacc
cctcttataggcattaataaccgcagcctacacaactttaaaacagacattcaactgagt
atccaattaaaacaattggttcctaaagataaaattattattactgaaagcggaatcaac
acccgtgaagacataaaattaatgcaatcccatggcattaatgcctttttgattggagag
agtttaatgagggcagataacatcggcaaagcattacaggaactaatggctaactaa

DBGET integrated database retrieval system