KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0906Help
Entry
lp12_0906         CDS       T01726                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpe00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lpe00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975679..976755
Genome map
AA seq 358 aa AA seqDB search
MITIRNKIGQMLIMGFHGSELHDNSPVAQWLSNDGLGGVLLFDKDLSTGIYGKNLRNQAQ
IRQLIRQLNRYASMISGGNDNLPLFTAIDYEGGVVDRLSKIEGCPPTMKARELAKLSSDD
FDEEVTQMAMTLQSLGFNLNFAPVVDLNLNAHAGIIGNLGRSFSSNPEVTIRLAKQFVDV
FSRYGIACAYKHFPGHGSATGDTHEGFVDVTETFQTDELIPYRSLLKDLSNPVMVMTAHV
INKHLDSKGLPATLSYDVLTLLLRQSIGYDGVIISDDLQMHAISNHYSLEEALCLTINAG
ADMVIFANQLGTITAPEVIDVIEKLVIDKQIPSQRIDEAYRRIVRLKQQIICSELINT
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgattacaataagaaacaaaatcggacaaatgctgattatgggatttcatggttccgag
ctgcatgataatagtccggttgctcaatggttatctaatgatggtctcggcggagtgttg
ttattcgacaaagatctatccacagggatttatggcaagaatttaaggaatcaggctcag
ataaggcaattgattcgacagcttaatcgttatgcatcaatgatttcaggaggtaatgac
aatctgcctttatttactgcgattgattacgaaggtggagtggttgacagactaagcaaa
atagaaggctgtccgcctactatgaaagccagggaacttgcaaagttatccagtgatgat
tttgatgaagaagtaactcaaatggctatgacgttgcagtcattaggttttaatttaaat
tttgccccggttgttgatttaaatttaaatgctcatgcagggattattggaaacctggga
agaagcttttcttctaacccagaggtgactattcgtttggccaagcagttcgttgatgtt
ttcagtcgttatggtattgcttgtgcgtataaacatttccccggccatggcagcgccact
ggagatacacatgagggatttgtcgatgttacagaaacctttcaaaccgatgagctaatt
ccttatcgaagtttattaaaagacctgtctaaccctgtcatggtaatgacggcacatgtg
atcaataagcatttggatagtaagggattgccagcaactctgtcctacgacgttttaaca
ttattgttacgtcaaagcataggatatgacggggtcattatcagcgatgatttgcaaatg
catgccatttcaaatcactattcattagaagaggctctttgtcttaccatcaatgccggg
gctgatatggtcatatttgccaatcagcttggaactattaccgcaccggaagttatagat
gtgattgaaaaactggtaattgacaagcaaattccctctcaacgtattgatgaggcgtac
agaagaatagtacgtctgaagcaacaaattatatgcagtgaattgatcaatacgtaa

DBGET integrated database retrieval system