KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0939Help
Entry
lp12_0939         CDS       T01726                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase MurE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    lp12_0939
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp12_0939
Enzymes [BR:lpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     lp12_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008534..1010000
Genome map
AA seq 488 aa AA seqDB search
MGANFVKLSQLLEPWIKRDIIDGTVSDIKNDSRLVKEGDLFAAYPGAASDGRLYIEKAVA
SGAVAVVYEPNNLPQGITLPTAIPCIAIPQLAEKLGEIAKRFFNNPSQFLGLTGVTGTNG
KTTIAYQLAQAHDLLGQHSAYIGTIGQGRVDSLKPLENTTPDALCLQRLMHQYKEGGIKQ
VCMEVSSHALSQHRVDSLEFSQAIFTNLTLDHLDYHQTMQAYGAAKSRLFERAELQWAII
NQDDDFQDLMSNVLKTHVKKVTYGMHQNCDVKAIQWNMDITGTEIEVKSPWGHHLLKIKA
LGKFNIYNSLAVYSSLLASGYNPEKVVQIMAELKAAPGRMEIVAQSPYVLVDYAHTPDAL
ENVLITLKQIKKGRLWVVFGCGGDRDKTKRPIMGKAASMYADNIVITSDNPRSEDPEIIL
NEIACGIPASAPVSKLVNREEAIAYALRKAEHNDIILIAGKGHESYQQIGNTKHVFSDQE
VVRRLMNN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
ataggagccaattttgtgaaactaagccaattattagaaccgtggattaaaagggacatt
attgatggcactgttagtgacataaaaaatgacagtcgtttggtgaaagaaggggattta
tttgcagcctatccaggggcagcttccgatggtcgattatatatagaaaaagctgtggca
tcaggtgctgtcgctgtggtttatgagcccaataatttacctcagggaattactttgcca
acagcaattccctgcatagccattccccaattagctgaaaaattaggagaaatagcgaaa
cggttttttaataacccatcccaatttcttggtttaactggggtaactggcacaaatggc
aagacgactattgcttatcagttggcacaggcacatgatttactcgggcagcactcggct
tacattgggactatagggcaaggcagggtggattccttaaaacctttggaaaatactacg
ccagatgctctttgtttgcagaggttgatgcatcagtataaagaagggggcattaaacag
gtttgtatggaggtatcctctcatgcgttgagtcagcatagagtcgactctctcgaattt
agtcaggctatctttaccaatttaacgctcgatcatttagattatcaccagacaatgcaa
gcttatggggctgcaaagtcgaggttgtttgaacgagcagagttgcaatgggctattatt
aatcaggatgacgactttcaagatctcatgagcaatgtgctaaagactcatgtaaaaaaa
gtgacttacggtatgcatcaaaattgcgatgtgaaagcgatccaatggaatatggatatc
accggaacagaaattgaagttaaatctccttgggggcaccaccttctaaagattaaagca
ctgggtaagtttaatatttataatagcctggctgtttatagcagtttgcttgccagcggg
tataatccagaaaaagtagtgcaaattatggctgaattaaaagcggctcctggccgaatg
gaaattgttgctcaatccccatatgttcttgttgattatgctcatactcccgatgcattg
gaaaatgttcttatcaccttaaaacaaataaaaaaagggagattgtgggttgtatttggt
tgtggtggggacagagataaaaccaaacggcccattatgggaaaggcagccagcatgtac
gctgataatattgtcattaccagcgataatccaagaagtgaagatccggaaattattcta
aatgaaattgcttgtggcattcctgcctctgcgcctgtctctaaactggtgaatagagaa
gaagcaattgcttatgctttaagaaaggctgaacataacgatatcatattaatagcagga
aaaggacatgaatcgtatcagcagattgggaatacaaaacatgttttttctgatcaggaa
gttgtaagacgtttgatgaataattaa

DBGET integrated database retrieval system