KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_0939Help
Entry
lp12_0939         CDS       T01726                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase MurE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lpe00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lpe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008534..1010000
Genome map
AA seq 488 aa AA seqDB search
MGANFVKLSQLLEPWIKRDIIDGTVSDIKNDSRLVKEGDLFAAYPGAASDGRLYIEKAVA
SGAVAVVYEPNNLPQGITLPTAIPCIAIPQLAEKLGEIAKRFFNNPSQFLGLTGVTGTNG
KTTIAYQLAQAHDLLGQHSAYIGTIGQGRVDSLKPLENTTPDALCLQRLMHQYKEGGIKQ
VCMEVSSHALSQHRVDSLEFSQAIFTNLTLDHLDYHQTMQAYGAAKSRLFERAELQWAII
NQDDDFQDLMSNVLKTHVKKVTYGMHQNCDVKAIQWNMDITGTEIEVKSPWGHHLLKIKA
LGKFNIYNSLAVYSSLLASGYNPEKVVQIMAELKAAPGRMEIVAQSPYVLVDYAHTPDAL
ENVLITLKQIKKGRLWVVFGCGGDRDKTKRPIMGKAASMYADNIVITSDNPRSEDPEIIL
NEIACGIPASAPVSKLVNREEAIAYALRKAEHNDIILIAGKGHESYQQIGNTKHVFSDQE
VVRRLMNN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
ataggagccaattttgtgaaactaagccaattattagaaccgtggattaaaagggacatt
attgatggcactgttagtgacataaaaaatgacagtcgtttggtgaaagaaggggattta
tttgcagcctatccaggggcagcttccgatggtcgattatatatagaaaaagctgtggca
tcaggtgctgtcgctgtggtttatgagcccaataatttacctcagggaattactttgcca
acagcaattccctgcatagccattccccaattagctgaaaaattaggagaaatagcgaaa
cggttttttaataacccatcccaatttcttggtttaactggggtaactggcacaaatggc
aagacgactattgcttatcagttggcacaggcacatgatttactcgggcagcactcggct
tacattgggactatagggcaaggcagggtggattccttaaaacctttggaaaatactacg
ccagatgctctttgtttgcagaggttgatgcatcagtataaagaagggggcattaaacag
gtttgtatggaggtatcctctcatgcgttgagtcagcatagagtcgactctctcgaattt
agtcaggctatctttaccaatttaacgctcgatcatttagattatcaccagacaatgcaa
gcttatggggctgcaaagtcgaggttgtttgaacgagcagagttgcaatgggctattatt
aatcaggatgacgactttcaagatctcatgagcaatgtgctaaagactcatgtaaaaaaa
gtgacttacggtatgcatcaaaattgcgatgtgaaagcgatccaatggaatatggatatc
accggaacagaaattgaagttaaatctccttgggggcaccaccttctaaagattaaagca
ctgggtaagtttaatatttataatagcctggctgtttatagcagtttgcttgccagcggg
tataatccagaaaaagtagtgcaaattatggctgaattaaaagcggctcctggccgaatg
gaaattgttgctcaatccccatatgttcttgttgattatgctcatactcccgatgcattg
gaaaatgttcttatcaccttaaaacaaataaaaaaagggagattgtgggttgtatttggt
tgtggtggggacagagataaaaccaaacggcccattatgggaaaggcagccagcatgtac
gctgataatattgtcattaccagcgataatccaagaagtgaagatccggaaattattcta
aatgaaattgcttgtggcattcctgcctctgcgcctgtctctaaactggtgaatagagaa
gaagcaattgcttatgctttaagaaaggctgaacataacgatatcatattaatagcagga
aaaggacatgaatcgtatcagcagattgggaatacaaaacatgttttttctgatcaggaa
gttgtaagacgtttgatgaataattaa

DBGET integrated database retrieval system