KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1172Help
Entry
lp12_1172         CDS       T01726                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    lp12_1172
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    lp12_1172
Enzymes [BR:lpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     lp12_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1281640..1282827
Genome map
AA seq 395 aa AA seqDB search
MAHIAIEKIKHFLMSLALKIKSIILSFFLVLVTTVACATQVSLRDKIGQMLILGFQGKVV
DEKSPIAQAIEKNNIGGVILFDFNQQSQTFDKNIESPEQVNRLNNQLQTLTQKANRKYHR
DNLPLLISVDYEGGNVNRLHPRYGFPEMPSAKDIGSMSLERADASAELMANTLKSTGFNL
NFFPELDVNINPDNPIIGKKDRSFSSIPEIVTQYAQLYTEQFIKHQIHCSYKHFPGHGSS
LSDSHLGFVDISDTWSEQELIPFLQLLSQPNHCDMVMIAHIVNRKLDMTGLPASLSYQII
NGLLRRDLKFDGVVITDDMQMKAITNYYGLETAVTLSINAGADMLIFGNQLVEKFQDSTE
IIDMIEQKVRSGEISEQRINEAYQRIVKMKRSFNY
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcatatcgcaatagagaaaattaagcattttctaatgagtttagcattgaaaatc
aagtcaattattttatctttttttcttgttttggtgactacggtagcttgtgccacacaa
gtgagtttgagagataaaattgggcaaatgttaatattaggattccagggcaaagtggtt
gacgagaaatcacctattgcccaggcaattgagaaaaacaacattggtggtgttattctt
tttgattttaatcagcagtcacaaacttttgataaaaatatagaaagtccggaacaagtt
aaccggttaaataatcagttacaaacacttacgcaaaaagccaatcgtaaatatcataga
gataatttaccattacttatttctgttgattacgaggggggaaacgttaatcgattgcat
ccccgttatggattccctgaaatgccttcagcaaaagatattggctccatgtctctggaa
agagctgatgcatcagcagaattgatggcaaatactttaaaatcaacaggatttaatttg
aattttttccctgaattagatgtgaatataaatccagataatcctatcataggcaaaaaa
gacaggagtttctcttcgataccggaaattgtcactcaatacgcgcaactttatacagag
caatttataaaacatcaaatacattgttcatataaacattttcctggacatggcagttca
ttatctgattcacatttgggttttgtagatataagtgacacctggagcgagcaagaatta
atcccttttttacaattattatctcaacccaatcattgcgatatggtgatgatagctcat
attgtgaatagaaaactggatatgacagggctacctgccagcctttcttaccagatcatt
aacggattattgcgtcgtgatttaaaatttgacggggttgttatcaccgatgatatgcaa
atgaaagcaataacgaattattatggattagaaactgctgttactctttcaattaatgca
ggagcagatatgctaatatttggtaatcaattggtagaaaaatttcaagactcgacagaa
atcattgacatgatcgagcaaaaagttcgatcgggagagatttctgaacaaaggattaat
gaagcttatcaacgaattgtaaaaatgaagaggtcttttaattattag

DBGET integrated database retrieval system