KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1180Help
Entry
lp12_1180         CDS       T01726                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpe01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lpe00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1288602..1289897)
Genome map
AA seq 431 aa AA seqDB search
MLTIKNWQLLSENDKRRCLSRPRDNSAIKENVLEIINQVQLSGDKALYDLTKRFDRVNLQ
YLQISQEKIRQASIPQNALIAIKQAIETISSYHQSLLPENTEISTASGITIRNVYRPIQK
VGLYVPGGNKTPLVSSLLMQAIPAKVAGCPIKVLCTPPDAEGEINEHILVAARLCGIDTI
YAIGGAQAIAAMAYGTESVIKVDKIFGPGNSYVTQAKTLVAIDADGAAIDMPAGPSEVMI
IADTEANPEFIAADLLAQAEHGPDSQVILICDECELANQVNQQLEIQMRYLSRIEFIKQS
LANSRIIICSNQSEQLDIINSYAPEHLIINRKNPEPWVEKIVAAGTVFLGSWAAETMGDY
VTGSNHVLPTSGFARNHSGLSTLDFMTRFTVQAINQEAIRNLGPAAMTLAELEGLDAHAN
AVQIRLNTLGD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgataaaaaactggcaattactgtctgagaacgataaaaggcgatgcctttca
aggccacgagacaattctgcaataaaggaaaatgtgctggaaattataaatcaggtccaa
ttatcaggagataaagcactttacgatttaaccaaacggtttgatagagtcaatttacaa
tatttacagatctcacaggaaaaaattagacaagccagcataccgcaaaatgccttaatc
gccataaaacaagccattgaaacaatctcgtcatatcaccagtctttgttgcctgaaaat
accgagatttcgactgcatcaggaattacaatccgcaatgtctacagaccaatccaaaaa
gttggcttgtatgtgcctggaggaaataaaacacctttagtttcttcgcttctcatgcaa
gcaattccggcaaaggtagcgggctgcccaataaaagtgctttgtactccccctgatgca
gaaggggaaattaacgagcatatcctggtagctgcaagattatgtggcatcgacacaatt
tacgctataggtggagctcaagccatagcggctatggcttatggcactgaaagtgtcatc
aaagtggataaaatattcgggccgggtaatagctatgtcactcaggcaaaaactttagtt
gcaattgacgccgacggagctgcgattgacatgcccgctgggccatctgaagtgatgatt
attgcagatactgaggcaaaccctgaatttattgctgcagatttattagcccaggctgaa
catggcccggattcacaggttattttaatttgtgatgaatgtgaattggcaaaccaggtt
aatcaacagctggaaattcagatgagatatttgtcaagaatagaatttatcaaacaatct
ctcgcgaatagcaggataattatctgttctaatcaatcggaacagctggatattatcaac
tcctacgctccggaacacctgatcattaacagaaaaaaccccgaaccatgggttgagaaa
atcgtggctgccggaacagtatttcttggctcttgggccgcagaaacaatgggtgattat
gtaacaggaagcaatcacgtcttacctaccagtggttttgccagaaaccatagcgggctt
tctactcttgattttatgacacgatttaccgtgcaagccataaatcaagaggctatccgt
aatttaggtccagcggcaatgactttagcggaattagagggtttggatgctcatgccaat
gccgttcaaataagactcaatactctgggggattaa

DBGET integrated database retrieval system