KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1242Help
Entry
lp12_1242         CDS       T01726                                 

Definition
tryptophan synthetase, beta subunit
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp12_1242
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp12_1242
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lp12_1242
Enzymes [BR:lpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lp12_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1348713..1349912
Genome map
AA seq 399 aa AA seqDB search
MIKKELPDEFGHFGPYGGMFVADTLVHALKQLEHAYTKYRNDQDFLSELHTELKDYVGRP
NPLYHAVHLSKKIGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQH
GVATATVAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSKTLKDALNEALR
DWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKTGHLPDALVACVGGGS
NAIGLFYPFLNDQSVMIYGVEAGGKGIETGEHSASLIAGKPGVLHGNRTYLLCDEYGQVK
DTHSVSAGLDYPGVGPEHAYLKDTGRVIYKAINDSEAMDAFRLLTHTEGIIPALESSHAV
AYAIQLAKTMSKEQSIIVNLSGRGDKDMHTVAAIDGITI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagagcttccagatgagtttggccattttggcccatatggcggtatgttt
gtagccgatacattagttcatgctttaaaacaattagagcatgcctataccaaatatcgt
aacgatcaggattttctgtctgagttacacacagaattaaaagattatgtggggcggccc
aatcctctataccatgccgtacacttaagcaaaaagataggcggtgcacaaatttatctc
aagcgtgaagatttaaatcataccggtgctcataaaatcaataataccattggacaagcc
ttactcgccaaacgtatggggaaaactcgagtgatcgcggaaacaggcgcgggtcaacat
ggcgttgcaactgctacagttgccgctaaatttgggtttcaatgcgttgtgtacatgggg
tcagaagacattaagcgtcaatccagtaatgtttatagaatgaaattgttaggtgctgaa
gtggtgcctgtcacttcaggatcaaagacgttgaaagatgctttaaatgaagcattgaga
gattgggtgagtcatgtcgacgacacgttttatattattggtactgttgcaggtccccat
ccttatcctcaaatggtaagagattttcaagcgattattggtgttgaagctcgagctcaa
catatggaaaaaacaggccatttgccagatgctttggtagcttgtgtcggaggtggatcc
aatgcaataggcttgttttatccctttttgaatgatcagtctgtcatgatttatggggtt
gaagcaggagggaaaggcatagaaaccggtgagcattcggcatctctgattgctggaaaa
cctggtgtgttacacggtaatagaacctatttattgtgtgatgagtatggacaggtgaaa
gacactcactcagtatcagccggtctggattatcctggagttgggcctgaacatgcttat
ttaaaagatactggacgggtcatttataaagcaataaatgattccgaggccatggatgcg
tttcgcctgttaactcatacggaaggaattattccagcattagaatctagccacgcggta
gcctatgccatacaattggctaaaaccatgtcaaaagaacaaagcatcatagtcaatcta
tctggtcgtggtgataaagatatgcatacagtagctgctattgacggtataacaatttaa

DBGET integrated database retrieval system